SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000026344 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000026344
Domain Number 1 Region: 99-213
Classification Level Classification E-value
Superfamily Fibronectin type III 1.66e-31
Family Fibronectin type III 0.0025
Further Details:      
 
Domain Number 2 Region: 22-121
Classification Level Classification E-value
Superfamily Fibronectin type III 1.46e-19
Family Fibronectin type III 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000026344   Gene: ENSMODG00000021068   Transcript: ENSMODT00000026813
Sequence length 330
Comment pep:novel chromosome:BROADO5:4:14481499:14546078:-1 gene:ENSMODG00000021068 transcript:ENSMODT00000026813 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERSFQTWLYSSCLLISVLGILPKPRNVRMNSVNLKNILQWDPPAFYQGNVTYRAQYESY
RSFEDVCTNIIITECNFSNISKYGESKMRVRTESVDEQSEWVNLTFCPLEDTIIGPPGIQ
VEPLAGSLHLYFSYPKIENEPNIWTLRDYYYSWTYRVIYWKNGTSHKFEKNAPYDSEVLT
DLDPWTVYCIQAQGFITSKNKSGEWSQPICVQTTDNESPPYWITIIVLIVSMIVVLLTAL
GCFSLLWYFYRKAKCIFFPGYSFPQPLKEYLEQHPYRISFLSPVPSSESESFDKLSIIKL
SENTEHDTTGPCNYSKEELQQSLLSGEKNS
Download sequence
Identical sequences F6V1X5
XP_007493332.1.35504 ENSMODP00000026344 ENSMODP00000026344

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]