SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000026408 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000026408
Domain Number 1 Region: 625-748
Classification Level Classification E-value
Superfamily EF-hand 5.27e-53
Family EF-hand modules in multidomain proteins 0.000000557
Further Details:      
 
Domain Number 2 Region: 750-846
Classification Level Classification E-value
Superfamily EF-hand 8.62e-40
Family EF-hand modules in multidomain proteins 0.00000412
Further Details:      
 
Domain Number 3 Region: 826-914
Classification Level Classification E-value
Superfamily RING/U-box 8.48e-22
Family ZZ domain 0.0092
Further Details:      
 
Domain Number 4 Region: 177-329
Classification Level Classification E-value
Superfamily Spectrin repeat 3.01e-21
Family Spectrin repeat 0.0014
Further Details:      
 
Domain Number 5 Region: 65-225
Classification Level Classification E-value
Superfamily Spectrin repeat 6.63e-21
Family Spectrin repeat 0.0094
Further Details:      
 
Domain Number 6 Region: 441-580
Classification Level Classification E-value
Superfamily Spectrin repeat 1.03e-18
Family Spectrin repeat 0.0051
Further Details:      
 
Domain Number 7 Region: 291-419
Classification Level Classification E-value
Superfamily Spectrin repeat 2.09e-18
Family Spectrin repeat 0.0055
Further Details:      
 
Domain Number 8 Region: 587-624
Classification Level Classification E-value
Superfamily WW domain 0.0000000000114
Family WW domain 0.00014
Further Details:      
 
Domain Number 9 Region: 10-83
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000482
Family Spectrin repeat 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000026408   Gene: ENSMODG00000021126   Transcript: ENSMODT00000026879
Sequence length 1226
Comment pep:novel chromosome:BROADO5:4:33452305:33877914:1 gene:ENSMODG00000021126 transcript:ENSMODT00000026879 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSSLLLEVPALADFNKAWTELTDWLSLLDRVIKTQRVMVGDLEDINDMIIKQKATLQDL
EQRRPQLEELITAAQNLKNKTGNQEARTIITDRIEKIQSQWDEVQEHLQRRRQQLNEMLK
DSAQWLEAKKEAEWTLEKAKTKLESWKEIPYTMEGIRKQSTETKQLAKDLRQWQINVDVA
NDLARKLLRDYSTDDTRKVQMITDNINATWADINKRVNEREAALEAAHRLLQQFPLDLEK
FLAWLTEAETTANVLQDATHKERILEDTKGVRELMKQWQDLQGEIEAHTDIFHNLDENGQ
KILKSLEGSDDAVLLKRRLDNMNFKWSELRKKSLNIRSHLEVSSDQWKRLHLSLQELLVW
LQLKDDELSRQAPIGGDYPAVQQQNDIHRAFKRELKTKEPVITSTLETVRIFLSEKPLEE
LEKHYQEPRELPPEERAHNVTRLLRKQADEVNSEWEKLNLHSVDWQKKIDEALGRLQDLQ
EAMDELDLKLRQAEVMRGSWQPVGDLLIDSLQEHLEKVKALRGEIAPLEENINHVNGLAR
QLTTSGIQLSPYNLNSLEDLNTRWKLLLVAIDERIRQLHEAHRDFGPTSQHFLSTSVQGP
WERAISPNKVPYYINHETQTTCWDHPKMTELYQSLADLNNVRFSAYRTAMKLRRLQKALC
LDLLSLSAACDALDQHNLKQNDQPMDILQIINCLTTIYDRLEQEHNNLVNVPLCVDMCLN
WLLNVYDTGRTGRIRVLSFKTGVISLCKAHLEDKYRYLFKQVASSMGFCDQRRLGLLLHD
SIQIPRQLGEVASFGGSNIEPSVRSCFQFANNKPEIEAALFLDWMRLEPQSMVWLPVLHR
VAAAETAKHQAKCNICKECPIIGFRYRSLKHFNYDICQSCFFSGRVAKGHKMHYPMVEYC
TPTTSGEDVRDFAKVLKNKFRTKRYFAKHPRMGYLPVQTVLEGDNMETPVTLINFWPVDS
APASSPQLSHDDTHSRIEHYASRLAEMENSNGSYLNDSISPNESIDDEHLLIQHYCQSLN
QESPLSQPRSPAQILISLESEERGELERILADLEEENRNLQAEYDRLKQQHEHKGLSPLP
SPPEMMPISPQSPRDAELIAEAKLLRQHKGRLEARMQILEDHNKQLESQLHRLRQLLEQP
QAEAKVNGTTVSSPSTSLQRSDSSQPMLLRVVGSQTSETMGKYKQLSPPPQDTSTGLEEV
MEQLNNSFPSTRGRNAPGKPMREDTM
Download sequence
Identical sequences F7AQW9
ENSMODP00000037545 ENSMODP00000026408

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]