SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000026423 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000026423
Domain Number 1 Region: 128-222
Classification Level Classification E-value
Superfamily Immunoglobulin 2.15e-22
Family I set domains 0.0023
Further Details:      
 
Domain Number 2 Region: 26-126
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000108
Family I set domains 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000026423   Gene: ENSMODG00000021138   Transcript: ENSMODT00000026894
Sequence length 277
Comment pep:novel chromosome:BROADO5:Un:59598119:59608777:1 gene:ENSMODG00000021138 transcript:ENSMODT00000026894 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSTLCSLLCFGLYLSQRIQAQEGSLPKPILSAETDLIMTPGSNLSLKCKKPDSDHLMPQ
KWTYLLLKEGNSQPLQNHTATGSWAKFSLLLVTDQDSGNYSCKYLEFQNPQREPEASSAL
EIWVKDILQKLSLSALPQRIITPGENVTLLCHGPAWGMRFALYKEGDEKPMQIHDPIQDE
AEFLLTYVTTNHTGNYSCHHHSDAVNQVMAQPSDPLELIVKGELDIPLRQALGSTTILII
FSCAIILFFLFLLAFCYHRSYIASLADGISLNVCCSH
Download sequence
Identical sequences H9H7U9
ENSMODP00000026423 ENSMODP00000026423 XP_007506839.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]