SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000026458 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000026458
Domain Number 1 Region: 36-105
Classification Level Classification E-value
Superfamily RuvA domain 2-like 3.85e-21
Family ComEA-like 0.011
Further Details:      
 
Domain Number 2 Region: 105-182
Classification Level Classification E-value
Superfamily RuvA domain 2-like 2.33e-20
Family ComEA-like 0.012
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000026458
Domain Number - Region: 255-300
Classification Level Classification E-value
Superfamily DNase I-like 0.0035
Family DNase I-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000026458   Gene: ENSMODG00000021168   Transcript: ENSMODT00000026931
Sequence length 304
Comment pep:novel chromosome:BROADO5:6:289402381:289422830:1 gene:ENSMODG00000021168 transcript:ENSMODT00000026931 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGTLGCHRSIPRDPADVAPSRKFSAACNFGHMLVNQERLNINAATEEELMTLPGVTRAV
ARSIVEYRRCIGGFKKVEDLALVSGVGAAKLEQVKFEICVSSKASSAQHSPSSARRDPHP
EPGRLNVNAASAAQLRGLRGVSERLALAIVEHRQERGPFRSVEDLLRLDGVSPASLDKLR
PQLFAAAVPSAERSRPPSTHTNGGLTFSAKPHPSPTSLSLQSEDLDFPPGGPTQLLSSRP
PVEAFGGTRDGRPVLRLATWNLHGCSADKANNPGVREVVCMTLLENSIKLLAVQELMDRE
ALEK
Download sequence
Identical sequences F6XX73
13616.ENSMODP00000026458 ENSMODP00000026458 ENSMODP00000026458

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]