SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000026482 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000026482
Domain Number 1 Region: 613-907
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.97e-83
Family Protein kinases, catalytic subunit 0.000000000528
Further Details:      
 
Domain Number 2 Region: 30-203
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.49e-74
Family Ephrin receptor ligand binding domain 0.000000865
Further Details:      
 
Domain Number 3 Region: 328-532
Classification Level Classification E-value
Superfamily Fibronectin type III 3.69e-40
Family Fibronectin type III 0.00013
Further Details:      
 
Domain Number 4 Region: 910-982
Classification Level Classification E-value
Superfamily SAM/Pointed domain 5.11e-21
Family SAM (sterile alpha motif) domain 0.0000422
Further Details:      
 
Domain Number 5 Region: 259-330,366-389
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000706
Family Growth factor receptor domain 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000026482   Gene: ENSMODG00000021189   Transcript: ENSMODT00000026955
Sequence length 986
Comment pep:novel chromosome:BROADO5:7:228354059:228511345:1 gene:ENSMODG00000021189 transcript:ENSMODT00000026955 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGILYFILFSFLFGICNGVTGSRIYPANEVTLLDSRSVQGELGWIASPLEGGWEEVSIM
DEKNTPIRTYQVCNVMESSQNNWLRTDWIPREGAQRVYIEIKFTLRDCNSLPGVMGTCKE
TFNLYYYESNNDKERFIRESQFAKIDTIAADESFTQVDIGDRIMKLNTEIRDVGPLSKKG
FYLAFQDVGACIALVSVRVFYKKCPLTVRNLAQFPDTITGADTSSLVEVRGSCVNNSEEK
DVPKMYCGADGEWLVPIGNCLCNAGHEERNGECQACKIGYYKALSTDTACAKCPPHSYSV
WEGSTSCTCDRGYFRAEDDAASMPCTRPPSAPLNLISNVNETSVNLEWSSPENTGGRQDI
SYNVVCKKCGAGEVNRCGSCGSGVHYTPQQNGLKSTKVSITDLLAHTNYTFEILAVNGVS
KYNPSQDQSVSVTVTTNQAAPSSIALIQAKEITRYSVALAWLEPDRPNGVILEYEVKYYE
KDQNERSYRIVRTASRNTDIKGLNPLTSYVFHVRARTAAGYGDFSEPFEVTTNTVPSRII
GDGTNSTVLLVSVSGSVVLVVILIAAFVISRRRSKYSKAKQEADEEKHLNQGVRTYVDPF
TYEDPNQAVREFAKEIDASCIKIEKVIGVGEFGEVCSGRLKVPGKREICVAIKTLKAGYT
DKQRRDFLSEASIMGQFDHPNIIHLEGVVTKCKPVMIITEYMENGSLDAFLRKNDGRFTV
IQLVGMLRGIGSGMKYLSDMSYVHRDLAARNILVNSNLVCKVSDFGMSRVLEDDPEAAYT
TRGGKIPIRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSYGERPYWDMSNQDVIKAIEEG
YRLPPPMDCPIALHQLMLDCWQKERSDRPKFGQIVNMLDKLIRNPNSLKRTGTESSRPNT
ALLDPSSPEFSAVVSVGDWLQAIKMDRYKDNFTAAGYTTLEAVVHMNQDDLARIGITAVT
HQNKILNSVQAMRTQMQQMHGRMVPV
Download sequence
Identical sequences F6XVY7
ENSMODP00000026482 XP_001365863.1.35504 ENSMODP00000026482

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]