SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000026652 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000026652
Domain Number 1 Region: 660-850
Classification Level Classification E-value
Superfamily Fibronectin type III 1.19e-37
Family Fibronectin type III 0.00024
Further Details:      
 
Domain Number 2 Region: 386-439,521-657
Classification Level Classification E-value
Superfamily Fibronectin type III 1.44e-37
Family Fibronectin type III 0.0000777
Further Details:      
 
Domain Number 3 Region: 874-1040
Classification Level Classification E-value
Superfamily Fibronectin type III 3.75e-34
Family Fibronectin type III 0.0012
Further Details:      
 
Domain Number 4 Region: 275-394
Classification Level Classification E-value
Superfamily Fibronectin type III 1.04e-18
Family Fibronectin type III 0.0000199
Further Details:      
 
Domain Number 5 Region: 1042-1137
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000273
Family Fibronectin type III 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000026652   Gene: ENSMODG00000021323   Transcript: ENSMODT00000027129
Sequence length 1193
Comment pep:novel chromosome:BROADO5:7:195071362:195341000:1 gene:ENSMODG00000021323 transcript:ENSMODT00000027129 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYVTMMMTDQIPLELPPLLSGEVAMMPHLVNGDGAQQVILVQVNPGESFTIRAEDGTLQC
IQGPAEVPMMSPNGSIPPIHVPPGYISQVIEDNTGVRRVVVTPQSPECYPPSYPSAISPT
HHLPPYLAHHPHFIHNSHTAFYPPVTGPGDMPPGFFPQHHLPPTLYGEQEIIPLYGMSSY
ITREDQYSKPQHKKLKERQTDRQNRLNSPPSSLYKSHLSNCTTVYNGYGKGHNAGSSGGG
GGGGGGGPGIKKTERRARSSPKSNDCDSQEYDSEAKRVQDILSGIEKPQVSNVQARTVLL
TWSPPTGLSSGDRPHNSPPYPYSYEVALSDKGRDGKYKIIYSGEELECSLKDLRPATDYH
VRVYAMYNSVKGSCSEPVSFTTHSCAPESPYPPKLSHRTKSSLTLQWKAPIDNGSKVTSY
LLEWDEKKNKDFGARNDCKYQPALFISANSIGNTNRSQLIIANVMGNASQINRGPCNLTT
VSCSSEPCCKSSDSDEAWNHQLQEASQDSLFHSRYTGEDATCTVKNLKRSTQYKFRLIAS
NVEGRSFPSEVLVCTTSPDRPGPPTRPFIKGLITPYGFSVKWDPPKDNGGSEILKYLLEI
SEGHSEANQWDVAYSGSATEYTFTHLKPGTLYKLRACCISTGGHSQCSDSLPVRTLSVAP
GQCRPPRVLGKAKHKEIHLQWDVPSSESGCEVSEYSVEMTEPKEAASEVYHGPDLECTVG
NLLPGTTYHFRVRALNDGGYGPYSETSEITTAAGPPGQCRAPCISFTPDSGVLVSWESPK
ISGADISEYRLEWGEDEESLEPVYHGTETSFEIKELLPAAHYCWTSRASNQAGAGPYSDL
VSCRTPASAPDAVSTLYVLEEETFGAYPTSPSVCLVLNWEEPCNNGSEIIAYNIDLGENS
ITVTDATSYVIKDLLPETSYRIRIQAVNEIGAGPFSHSIKAKTRPLPPSPPRLECAAAGP
QSLKLKWGDSNSKMHPADDMVYTLQLEDRNKRFIPIYRGPSHTYKVQRLTEFTCYSFRIQ
AVNDAGEGPFSETYTFSTTKCIPPTIKAPRVTQLEGNACEISWETVPPMRGDPINYILQV
LVGRESDYKQVYKGEDATFQISGLQSNTDYRFRVCVCRRCLDTSQELSGAFSPSAAFVLQ
RNEMMLAGETGCFDDPKRKSPMPTDGQFAALIVLGFASLSVLFAFILQYFLMK
Download sequence
Identical sequences F7FT00
ENSMODP00000026652 13616.ENSMODP00000026652 ENSMODP00000026652

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]