SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000026699 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000026699
Domain Number 1 Region: 94-175
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000281
Family I set domains 0.012
Further Details:      
 
Domain Number 2 Region: 11-98
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000343
Family I set domains 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000026699   Gene: ENSMODG00000027857   Transcript: ENSMODT00000027178
Sequence length 226
Comment pep:novel chromosome:BROADO5:Un:56953311:56982249:-1 gene:ENSMODG00000027857 transcript:ENSMODT00000027178 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIYALLSKPTIITSNNTAVETKDFSMTCNATGQIPAYRWFINGLAPVGSRIQLSPDKRIL
TLRRLTRTENKGPYVCEIENPLFRNRSDPFPLNVTYGPDIATIVRSPDVYPTGANITLSC
VADSNPPAQFTWLQNGQSVRNSATFSVIASLNHAGTYTCIASNSFTGLTHTATKNIIIYG
EYLDWATNFVLGFLFPWYERNRHKIFCPPGPMTQYIVVERALSSES
Download sequence
Identical sequences M9MMI4
ENSMODP00000026699 XP_007506802.2.35504 ENSMODP00000026699

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]