SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000026712 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000026712
Domain Number 1 Region: 91-168
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000524
Family I set domains 0.024
Further Details:      
 
Domain Number 2 Region: 4-95
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000649
Family I set domains 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000026712   Gene: ENSMODG00000023869   Transcript: ENSMODT00000027191
Sequence length 202
Comment pep:novel chromosome:BROADO5:4:368687282:368732747:1 gene:ENSMODG00000023869 transcript:ENSMODT00000027191 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GPLSRPIINSPNRIPVENIDTVSLTCNATGQVRTYQWFINNRAPTDNRIQLTRDKRTLTV
GSLTREHEGSYVCEIKNPFYSNRSDPFTLNVYYGPDNAIILPKVDRYPVGTNITLSCSAK
SKPPAKFIWFHKGKKWRPSAKLSLTNVSLKHAGTYICQAFNSHTGLNSTKDKTLTIYVEE
KNFTDSEEKNVKINAEFTMYGE
Download sequence
Identical sequences F7CW39
ENSMODP00000026712 ENSMODP00000026712

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]