SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000026718 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000026718
Domain Number 1 Region: 421-502
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000688
Family I set domains 0.013
Further Details:      
 
Domain Number 2 Region: 245-326
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000254
Family I set domains 0.014
Further Details:      
 
Domain Number 3 Region: 591-672
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000753
Family I set domains 0.021
Further Details:      
 
Domain Number 4 Region: 786-852
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000119
Family I set domains 0.021
Further Details:      
 
Domain Number 5 Region: 47-149
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000132
Family I set domains 0.018
Further Details:      
 
Domain Number 6 Region: 865-953
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000454
Family I set domains 0.019
Further Details:      
 
Domain Number 7 Region: 943-1023
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000456
Family I set domains 0.027
Further Details:      
 
Domain Number 8 Region: 130-235
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000184
Family I set domains 0.0081
Further Details:      
 
Domain Number 9 Region: 1-71
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000122
Family I set domains 0.019
Further Details:      
 
Domain Number 10 Region: 512-597
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000193
Family I set domains 0.015
Further Details:      
 
Domain Number 11 Region: 689-777
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000363
Family I set domains 0.017
Further Details:      
 
Domain Number 12 Region: 340-425
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000621
Family I set domains 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000026718   Gene: ENSMODG00000021382   Transcript: ENSMODT00000027197
Sequence length 1036
Comment pep:novel chromosome:BROADO5:Un:3609877:3942947:1 gene:ENSMODG00000021382 transcript:ENSMODT00000027197 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTCQATGQNHTYQWFINNRAPSGSRLQLSPDKRTFTIRSVTRRENKGPYVCEIKNPFYSN
RSDPLTLNVTYGPDTPVIVPTIDAYPIGANITLLCSAVSNPPAQFNWLYNGQQVSNSATF
STITFLSQSGTYTCHASNSFTGLQATKDMNITIYAPLSKPTILISNNTAVETKDFSFTCQ
AKGQIHTYRWFINGLAAAGSRIQLSPDNRTLTLPRLTRRDNKGPYVCEIENPLFRNRSDP
FPLDVTYGPDIATIVHSADEYPTGANITLSCVADSNPAAQFTWLHNGQPVSNSATFSVIA
SLSDAGTYTCTASNSFTGLTRTATKNIIIYAPLSKPTILTSNNTEVETKDFSLTCYATGQ
IHAYKWFINGVAPAGRRIQLSPDRRTLTLSSLTRSVNKGPYVCEIENPFYRNRSDPFTLD
VAYGPDIATIVHSADEYPPGANITLSCVADSNPAAQFTWFHNGQPVSNSATFSIIASLSD
AGNYTCTAYNSFTGLTRTATKNIIIYAPLSKPTIVTSNITAVETKDFSLTCQATGQIHAY
QWFINLVAPAGSRIQLSPDKRTLTLSRLTRRDNKGPYECEIRNPFYSNRSYPFTLDVAYG
PYIATIDHISDQFATGINVTLSCVADSNPPAQFTWLQNGQSVSNSASFSIITSLNHIGNY
TCIATNSFTGLTRTANKTLMIYAPVSKPTIVTSNITAVETKDFSLTCQATGQIHAYQWLI
NRVAPAGSRIQLSPDKRTLTLSRLTRRDNKVPYECEIRNPFYSNRSDPFTLDVAYGPDIA
TIDHISDQFATGINVTLSCVADSNPPAQFTWLQNGQSVSNSASFSIITSLNHIGNYTCIA
TNSFTGLTRTANKTLMIYAPLSKPTIVTSNITAVETKDFSLTCQATGQIHAYQWFMNGVA
PAGSRIQLSPDKRTLTLSRLTRRDNKGPYECEIRNPFYSNRSDPFTLDVAYGPDIATIDH
ISDQFATGINVTLSCVADSKPPAQFTWLQNGQSVSNSASFSIITSLNHIGNYTCIATNSF
TGLTRTANKTLMIYGE
Download sequence
Identical sequences H9H811
ENSMODP00000026718 ENSMODP00000026718

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]