SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000026734 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000026734
Domain Number 1 Region: 137-242
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000206
Family V set domains (antibody variable domain-like) 0.035
Further Details:      
 
Domain Number 2 Region: 24-110
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000781
Family V set domains (antibody variable domain-like) 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000026734   Gene: ENSMODG00000021399   Transcript: ENSMODT00000027215
Sequence length 329
Comment pep:novel chromosome:BROADO5:3:293988755:294088544:-1 gene:ENSMODG00000021399 transcript:ENSMODT00000027215 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLCLLLFVVLQAHKAISEEKFVDTTIKLAKNMIFECEYPGLEFTSQAEWFKITTKGKDSM
AIFNPEYGELIRMNYINRVHFFNSSVAANVSLFFHNASKADVGLYSCSLQLFPLGLWEKV
IKVVQSDGFETRVPSNSHVESEPGNNVKLVFQTHMASPLKYVTWERIQPHQIDHLTSCNL
NKGKSYGFKYHRKILTSCSQGMKSSFIVIHNITASDSGFYQCCLTTSTGENETFVMKLTV
TDAKTDYRIIFFIAGGAASFLILVMFVIIISYCCMRKRRKKIFSKALWDFQIQSSNNYDR
SGISDQTQDYKEEDIYVNCPAFSQRPQPR
Download sequence
Identical sequences F7CVI6
ENSMODP00000026734 ENSMODP00000026734 XP_007487841.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]