SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000026918 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000026918
Domain Number 1 Region: 181-308
Classification Level Classification E-value
Superfamily Restriction endonuclease-like 5.09e-53
Family XPF/Rad1/Mus81 nuclease 0.000000518
Further Details:      
 
Domain Number 2 Region: 307-375
Classification Level Classification E-value
Superfamily RuvA domain 2-like 0.00000000000000121
Family Hef domain-like 0.0000825
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000026918   Gene: ENSMODG00000021546   Transcript: ENSMODT00000027400
Sequence length 380
Comment pep:novel chromosome:BROADO5:4:397432647:397442005:1 gene:ENSMODG00000021546 transcript:ENSMODT00000027400 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLGGTEKPEVPLPVAEVGLFSCSLLQVLRWVSAALETELRLGGQSLGSFGRAHAALGER
RALGTGCPGAPSRGRSETTQNRAGGQETKMDSKKEAAEESTQPPERKKFTIPLEEAPPLE
VKSLFKSSRNLPSPGTSVLGSNPTYADYTTARLGPGRAQPEAIPHTANQGPQGPKPTTKS
NSILVSPRQRGNPVLKFIRNVPWEFGEIVPDYVLGQSTCALFLSLRYHNLHPNYIHERLQ
GLGKNYALRVLLLQVDVKDPQRALKDLAKMCILADCTLILAWSPEEAGRYLETYKSYEQK
PADLLKEKLEQDFVSRVTECLTTVKSVNKTDSQTLLATFGSLEQLTAASQEDLSLCPGFG
PQKARRLFDVLHQPFLKVPL
Download sequence
Identical sequences F7DZM3
ENSMODP00000026918 ENSMODP00000026918

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]