SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000026964 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000026964
Domain Number 1 Region: 96-176
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000844
Family I set domains 0.021
Further Details:      
 
Domain Number 2 Region: 18-106
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000257
Family I set domains 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000026964   Gene: ENSMODG00000022559   Transcript: ENSMODT00000028411
Sequence length 186
Comment pep:novel chromosome:BROADO5:Un:86857724:86860171:1 gene:ENSMODG00000022559 transcript:ENSMODT00000028411 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QHSHFLSILCAAPLSKPTIVTSNITAVETKDFSLTCQATGQIHAYQWFINGVAPAGSRIQ
LSPDKRTLTLSRLTRRDNKGPYECEIRNPFYSNRSDPFTLDVAYGPDIATIDHVSDQFAT
GINVTLSCVADSNPPAQFTWLQNGQSVSNSASFSIITSLNHIGNYTCIATNSFTGLTRTA
NKTLMI
Download sequence
Identical sequences H9H844
ENSMODP00000026965 ENSMODP00000026964 13616.ENSMODP00000026965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]