SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000026973 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000026973
Domain Number 1 Region: 99-179
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000089
Family I set domains 0.021
Further Details:      
 
Domain Number 2 Region: 21-109
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000177
Family I set domains 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000026973   Gene: ENSMODG00000022569   Transcript: ENSMODT00000028423
Sequence length 192
Comment pep:novel chromosome:BROADO5:Un:83381319:83382463:-1 gene:ENSMODG00000022569 transcript:ENSMODT00000028423 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EKEPTQSFLSILCAAPLSKPTIVTSNITAVEAKDFSLTCQATGQIHTYQWFINGVAPAGS
RIQLSPDKRTLTLSRLTERDTKGPYECEIRNPFYSNRSDPFTLDVAYGPDIATIDHISDQ
FATGINVTLSCVADSNPPAQFTWLQNGQSVSNSASFSIITSLNHIGNYTCIATNSFTGLT
RSANKTLMIYGE
Download sequence
Identical sequences H9H852
ENSMODP00000026973 ENSMODP00000026973

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]