SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000026982 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000026982
Domain Number 1 Region: 116-180
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000187
Family I set domains 0.015
Further Details:      
 
Domain Number 2 Region: 18-106
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000276
Family I set domains 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000026982   Gene: ENSMODG00000022588   Transcript: ENSMODT00000028441
Sequence length 189
Comment pep:novel chromosome:BROADO5:Un:76975781:76976746:-1 gene:ENSMODG00000022588 transcript:ENSMODT00000028441 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QHSHFLSILCAAPVSKPTILTSNITAVETKDFSLTCQATGQIHAYQWFINGVATAGSRIQ
LSPHKRTLTLSSLTRFDNKGPYECEIRNPFYSNRSDAFTLDVAYGPDTATIDRISDQFAT
GINVTLSCVADSNPPAQFTWLQNGQSVSNSASFSIITSLNHIGNYTCIATNSFTGLKRTA
NKTLMIYGE
Download sequence
Identical sequences H9H861
ENSMODP00000026982 ENSMODP00000026982

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]