SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000026995 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000026995
Domain Number 1 Region: 102-169
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000573
Family I set domains 0.03
Further Details:      
 
Domain Number 2 Region: 6-94
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000013
Family I set domains 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000026995   Gene: ENSMODG00000022594   Transcript: ENSMODT00000028455
Sequence length 177
Comment pep:novel chromosome:BROADO5:Un:74769540:74770443:1 gene:ENSMODG00000022594 transcript:ENSMODT00000028455 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PLSKPTIVISNITAVETKDFSLTCQARGQIHTYQWFINGVAPAGSRIQLSPDKRTLTLSR
LTRRDNKGPYECEIRNPFYSNRSDPFTLDVAYGPDIATIDHISDQFATGINVTLSCVVDS
NPPAQFTWLQNGQSVSNSASFSIITSLNHIGNYTCIATNSFTGLTRTANKTLMIYGE
Download sequence
Identical sequences H9H874
ENSMODP00000026995 13616.ENSMODP00000026995 ENSMODP00000026995

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]