SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000027012 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000027012
Domain Number 1 Region: 101-181
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000018
Family I set domains 0.021
Further Details:      
 
Domain Number 2 Region: 23-111
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000793
Family I set domains 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000027012   Gene: ENSMODG00000022617   Transcript: ENSMODT00000028482
Sequence length 194
Comment pep:novel chromosome:BROADO5:Un:69073593:69074626:-1 gene:ENSMODG00000022617 transcript:ENSMODT00000028482 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GKKKNQHSHFLSILCTAPLSKPTIVTSNITAVETKDFSLTCQATGQIHPYQWFINGVATA
GSRIQLSPDKRTLTLSSLTRFDNKGPYECEIRNPFYSNRSDPFTLDVAYGPDIATIDRIS
DQFATGINVTLSCVADSNPPAQFTWLQNGQSVSNSASFSIITSLNHIGNYTCIATNSFTG
LKHTANKTLMIYGE
Download sequence
Identical sequences H9H891
ENSMODP00000027012 ENSMODP00000027012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]