SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000027019 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000027019
Domain Number 1 Region: 27-122
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000017
Family I set domains 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000027019   Gene: ENSMODG00000022639   Transcript: ENSMODT00000028503
Sequence length 127
Comment pep:novel chromosome:BROADO5:Un:66330748:66335068:1 gene:ENSMODG00000022639 transcript:ENSMODT00000028503 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IARLRERGRVWLLIHVLCISLPGTQTRFSQEPSDQTVVAGQRAVLSCVLLNYSGIVQWTK
DGLALGMGQGLKAWPRYQIVGSAEAGQYNLEITDAELSDDASYECQATEAALRSRKAKLT
VLSKKPL
Download sequence
Identical sequences H9H898
ENSMODP00000027019 ENSMODP00000027019

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]