SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000027101 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000027101
Domain Number 1 Region: 3-97
Classification Level Classification E-value
Superfamily Immunoglobulin 4.78e-32
Family V set domains (antibody variable domain-like) 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000027101   Gene: ENSMODG00000022699   Transcript: ENSMODT00000028610
Sequence length 103
Comment pep:novel chromosome:BROADO5:Un:52413484:52413792:-1 gene:ENSMODG00000022699 transcript:ENSMODT00000028610 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QPVVTQPPSASAALGSSARLSCTLSSGISGNYVYWHQQSPGKPPRYLLYVYSDGGTGRAD
GIPERFSGSSSGADRFLSISNVQPEDEADYFCQSYYYDSGSYP
Download sequence
Identical sequences H9H8H7
ENSMODP00000027101 ENSMODP00000027101 13616.ENSMODP00000027101

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]