SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000027200 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000027200
Domain Number 1 Region: 107-188
Classification Level Classification E-value
Superfamily Immunoglobulin 5e-16
Family I set domains 0.01
Further Details:      
 
Domain Number 2 Region: 24-111
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000759
Family I set domains 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000027200   Gene: ENSMODG00000028371   Transcript: ENSMODT00000028725
Sequence length 217
Comment pep:novel chromosome:BROADO5:Un:66969837:66971020:1 gene:ENSMODG00000028371 transcript:ENSMODT00000028725 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GKKKNQHSHFLSILCTAPLSKPTILTSNNTAVETKDFSLTCNATGQIHAYKWFINGVAPA
GRRIQLSPDRRTLTLSSLTRSVNKGPYVCEIENPFYRNRSDPFTLDVAYGPDIATIVHSA
DEYPPGANITLSCVADSNPAAQFTWLHNGQPVSNSATFSIIASLSDAGTYTCTASNSFTG
LTRTATKNIIIYGEYLDWAPNFVWGSLFPWHDRNRQK
Download sequence
Identical sequences M9MMI5
ENSMODP00000027200 ENSMODP00000027200

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]