SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000027208 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000027208
Domain Number 1 Region: 267-348
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000963
Family I set domains 0.014
Further Details:      
 
Domain Number 2 Region: 795-875
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000022
Family I set domains 0.0094
Further Details:      
 
Domain Number 3 Region: 619-699
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000258
Family I set domains 0.0094
Further Details:      
 
Domain Number 4 Region: 107-173
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000119
Family I set domains 0.021
Further Details:      
 
Domain Number 5 Region: 459-525
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000141
Family I set domains 0.021
Further Details:      
 
Domain Number 6 Region: 991-1053
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000251
Family I set domains 0.021
Further Details:      
 
Domain Number 7 Region: 362-452
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000005
Family I set domains 0.02
Further Details:      
 
Domain Number 8 Region: 12-98
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000791
Family I set domains 0.019
Further Details:      
 
Domain Number 9 Region: 890-978
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000954
Family I set domains 0.013
Further Details:      
 
Domain Number 10 Region: 715-802
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000331
Family I set domains 0.013
Further Details:      
 
Domain Number 11 Region: 539-626
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000389
Family I set domains 0.017
Further Details:      
 
Domain Number 12 Region: 187-274
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000107
Family I set domains 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000027208   Gene: ENSMODG00000028893   Transcript: ENSMODT00000028738
Sequence length 1062
Comment pep:novel chromosome:BROADO5:Un:37888365:38036044:-1 gene:ENSMODG00000028893 transcript:ENSMODT00000028738 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIYAPVSKPSIVTSNITAVETKDFSLTCQATGQIHAYQWFINGVAPAGSRIQLSPDKRTL
TLSRLTRRDNKGPYECEIRNPFYSNRSDPFTLDVAYGPDIATIDHISDQFATGINVTLSC
VADSNPPAQFTWLQNGQSVSNSASFSIITSLNHIGNYTCIATNSFTGLTRSANKTLMIYA
PLSKPTILTSNNTAVETKDFSLTCNATGQIHAYKWFINGVAPAGLRIQLSPDRRTLTLRS
LTRSYNKGPYVCEIENPFYRNRSDPFTLDVAYGPDIATIVHSPDEYPTGANITLSCVADS
NPAAQFTWLHNGQPVSNSATFSIIASLSDAGTYTCTASNSFTGLTRTATKNIIIYAPVSK
PTIVTSNITAVETKDFSLTCQATGQIHAYQWFINGVAPAGNRIQLSPDKRTLTLSRLTRR
DNKGPYECEIRNPFYSNRSDPFTLDVAYGPDIATIDHISDQFATGINVTLSCVADSNPPA
QFTWLQNGQSVSNSASFSIITSLNHIGNYTCIATNSFTGLTRTANKTLMIYAPLSKPTIL
TSNNTAVETNDFSMTCNATGQIHGYKWFIDGVAPAGRRIQLSPDRRTLTIRSLRRSENKG
PYVCEIENPFYRNRSDPFTLDVAYGPDIATIVHSANEYPTGANITLSCVADSNPAAQFTW
LQNGQRISNSATFSVIASLSDAGTYTCTASNLFTGLTRTATKNIIIYAPLSKPTIITSNN
TAVETKDFSMTCNATGQIHPYRWFINGLAPGGNRIQLSPDNRTLTISSLRRSENKGPYVC
EIENPLFRNRSDPFTLNVTYGPDIATIVHSANEYPTGANITLSCVADSNPAAQFTWLQNG
QRISNSATFSVIASLSDAGTYTCTASNLFTGLTRTATKNITIYAPLSKPTIVTSNITAVE
TKDFSLTCQATGQIHAYQWFINGVAPAGSRIQLSPDKRTLTLSRLTRRDNKGPYECEIQN
PFSSNRSDPFPLNVTYGPDIATIDHISDQFATGINVTLSCVADSNPPAQFTWLQNGQSVS
NSASFSIITSLNHIGNYTCIATNSFTGLTRTANKTLMIYGMF
Download sequence
Identical sequences M9MMI7
ENSMODP00000027208 ENSMODP00000027208

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]