SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000027238 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000027238
Domain Number 1 Region: 84-164
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000828
Family I set domains 0.014
Further Details:      
 
Domain Number 2 Region: 6-94
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000008
Family I set domains 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000027238   Gene: ENSMODG00000027788   Transcript: ENSMODT00000028779
Sequence length 175
Comment pep:novel chromosome:BROADO5:Un:53193714:53223933:-1 gene:ENSMODG00000027788 transcript:ENSMODT00000028779 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PLSKPTIVTSNITAVETKDFSMTCQATGQIHAYRWFINGVAPAGSRIQLSPDKKILTIPN
LTRRDNKGPYVCEIENPLFSNRSDPFTLDVAYGPDIAMIVRTQDVYPTGANITLSCSAIS
NPPVQFTWLQNGQPVSNSATFSFIASLNRAGTYTCIASNSFTGLAHTANKTLIIY
Download sequence
Identical sequences M9MMI8
ENSMODP00000027238 ENSMODP00000027238

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]