SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000027243 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000027243
Domain Number 1 Region: 529-852
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.37e-86
Family Protein kinases, catalytic subunit 0.000000108
Further Details:      
 
Domain Number 2 Region: 260-382
Classification Level Classification E-value
Superfamily SEA domain 3.14e-38
Family SEA domain 0.00046
Further Details:      
 
Domain Number 3 Region: 9-131
Classification Level Classification E-value
Superfamily SEA domain 3.14e-26
Family SEA domain 0.00066
Further Details:      
 
Domain Number 4 Region: 395-462
Classification Level Classification E-value
Superfamily Cysteine-rich domain 1.94e-16
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000027243   Gene: ENSMODG00000022776   Transcript: ENSMODT00000028784
Sequence length 871
Comment pep:novel chromosome:BROADO5:Un:33088283:33324278:1 gene:ENSMODG00000022776 transcript:ENSMODT00000028784 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGYLSFCTVSWSSYYKNFTLSFTITNMFYTTKMNQKDSRTFKAAEHILQILLKVLFGSSR
IGSQYSGCSDLSLRSLRNRIATGVDIVCSFKKDSSNHVLDKKVVYWELTEQLCTRKLKHL
VIDNDSLIVNGSEAGVGAVTHIPDHGEPGKIMTSLTSGLLIRESTVYAIASEIGVGPFTH
IRDHGSARDMTSVTSESTAGAMGGDAGVVPDTHAQGHDAPGSTVAPIRSSLTPVSTIIPT
GPNIVPPFLRSPSWRDAGRYNWKSFILNFTITNMFYTTKMAQRDSSTFRLPECFLQRMFK
VLFERSSLGFQYCGCNVILLRSMKNGAATGVEVICFYKEVFSVPVLDKKKIYQELSQETN
GITRLGHYILDKKSLYVDGYNPQMPPRSTKESVYHHGTRRWRKLYRMNGHLFQSKRFNRR
AYCGQCSERLWCLGRQGYKCIDCKLLVHKGCHILVSQTCKRHMDLVMPSQEPQVEDKNDK
DDLPSEENDGLAYVPSTWKHDSLKDDSGDIKPVIDGMDGIKISQGLGLQDFDLIRVIGRG
SYAKVLLVRLKKNDQIYAMKVVKKKFVHDHENTNWVQTEKHVFEQASSNPFLVGLHSCFQ
TRSHLFLVIEYVNGGDLLFHMQRKNKLPEEHTRFYAAEICIALNFLHERGIIYRDLKLDN
ILLDTEGHIKLTDYGICKEGLGPGDTTRTFCGTPNYIAPEILRGEEYGFSVDWWALGVLM
FEMMVGRSPFDIITDKLDMATEDDLFQVILEKPIQIPRFLSVKASRVLKGFLNKDPKGRL
GCQPQTGFSDIKSHTFFRSIDWDLLEKKQALPPFQPQITDDYGLDNFDTQFTSEPVQLTP
DDENVIKRIDQSEFEGFEYINPLLLSTEESV
Download sequence
Identical sequences H9H8W3
ENSMODP00000027243 ENSMODP00000027243

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]