SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000027369 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000027369
Domain Number 1 Region: 31-142
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.9e-38
Family Spermadhesin, CUB domain 0.00018
Further Details:      
 
Domain Number 2 Region: 245-359
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.07e-34
Family Spermadhesin, CUB domain 0.00043
Further Details:      
 
Domain Number 3 Region: 145-242
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.88e-32
Family Spermadhesin, CUB domain 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000027369   Gene: ENSMODG00000022807   Transcript: ENSMODT00000028910
Sequence length 427
Comment pep:novel chromosome:BROADO5:Un:18462160:18485064:-1 gene:ENSMODG00000022807 transcript:ENSMODT00000028910 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKQSLSCSWSLLLIALRTVGLPAYGKKGIKCGGVLSGPSGNFSSPNFPGLYPYDTECSWL
IVVAEGSSILLTFHAFDLEYHDHCGYDYLKIYNGAASDESNLLGQFCGQSRPPPFTSSWH
IMSVVFHSDKHVASWGFSAGYRKDSCGGVLTGLSGVITSPEYPSSYPNNAECHWVIRASG
SSSIKLVFADFQVESNRACNYDYVHYCGSTKPPDLVSAGREVQVVFKSDFNIAGRGFKAF
YFSGECQEVYMAVKGNFSSPQYPGSYPNNLRCHWTIQMPPGYRVKVFFLDLDLEERNLLS
SSCDFDYLAAFDGASEAASLLGKWCGREMPAPIMSSHNQLLLVLHTDRNTAQRGFSVAYI
GVVPMNISCTRTDFQIQIAIRSLAQLDRSQIYLGSRSCPAQVVGDHFKIQARFDTCGTES
QNKLGVQ
Download sequence
Identical sequences H9H989
ENSMODP00000027369 ENSMODP00000027369

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]