SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000027544 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000027544
Domain Number 1 Region: 830-1024
Classification Level Classification E-value
Superfamily Fibronectin type III 6.36e-38
Family Fibronectin type III 0.00066
Further Details:      
 
Domain Number 2 Region: 635-832
Classification Level Classification E-value
Superfamily Fibronectin type III 7.66e-30
Family Fibronectin type III 0.00011
Further Details:      
 
Domain Number 3 Region: 276-363
Classification Level Classification E-value
Superfamily Immunoglobulin 7.36e-19
Family I set domains 0.02
Further Details:      
 
Domain Number 4 Region: 350-446
Classification Level Classification E-value
Superfamily Immunoglobulin 2.25e-17
Family I set domains 0.011
Further Details:      
 
Domain Number 5 Region: 461-548
Classification Level Classification E-value
Superfamily Immunoglobulin 1.23e-16
Family I set domains 0.035
Further Details:      
 
Domain Number 6 Region: 542-639
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000134
Family I set domains 0.024
Further Details:      
 
Domain Number 7 Region: 57-164
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000391
Family I set domains 0.016
Further Details:      
 
Domain Number 8 Region: 164-236
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000627
Family I set domains 0.03
Further Details:      
 
Domain Number 9 Region: 1047-1112
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000129
Family Fibronectin type III 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000027544   Gene: ENSMODG00000008677   Transcript: ENSMODT00000029084
Sequence length 1287
Comment pep:novel chromosome:BROADO5:X:11702779:11732653:-1 gene:ENSMODG00000008677 transcript:ENSMODT00000029084 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKLSSLSPSFPPVFPSFPTTQSASLLLPWSPHTNHVHSCVFCCLSCCGDLTDHMHMMQP
PNITEQSPEKLVVFPTDDIVLKCEASGKPEVQFRWTKENIHFSPEKELGATTHINSGSFI
ITGNTSNFAQRYQGTYRCFASNRLGTAMSHEIHLVAEGAPKWPKEKVQPFEVEEGQSVVL
PCNPPASAVQPRIYWMNSRIFHIAQDERVTMGQNGNLYFANVLTNDSHSDYICHAHFLGA
RTIMQKEPIDLRVKPTNNMIYRRPRLLLPEGLTSRLVALRGQPLVLECIAEGFPTPTIKW
SYPSNQMQAGRVTYQNFNKTLRLVRVEEEDDGEYRCWAENTLGSAQHVYYVTVEAAPYWL
QEPESLVLAPGETARLNCQVQGRPRPMVTWRINGVSLENLTRDDKLRVQGGALILSNVQP
NDTMVTQCEARNKHGLLLANAYISVVQLPTKILTPDNKTYREVQGSTAYLLCNAFGVPMP
SIQWLNRDQATVLQDERFVPYANGTLAIRDLQTNDTGSYFCQADNDQNRVSIKAHLQVKE
ATQIKKGPEDRTVKKGSNVNFPCLVSFDPSLNIQIDWYWNDQNIKDFYKEDKYLIKEEEL
TIISLDYADQGNYSCVAKTALDSVEKKATVLVVGSPGPVGQLELYKQKDFHVQLSWSPAE
EHNSPIEKYNIEFEDRTMEPGTWYPLATVPGNETSTRLKLSPFVHYNFRVIANNKFGASE
PSPDSEPFITPKSVPEKNPTNVKGEGNETNNMVITWKPLKWIDWNGPELKYRVQWRQKNE
SEWREVMVRASKYVVSNTPTFVPYEIKVQAINEVGKGPDPHIVIGYSGEDVPQAIPIVAI
ELLNATTVRIKWEPVDLNEVRGHLRGYRVTYWWVNSRWSRSKRHTPKTIIDKPASAMEAV
LPDLRPYSIYSVHVQVFNSRSLGPPSETIKFETEEGVPDRPQSLNLRRLSDTALQLSWRP
PLNPNGELKGYQLIYRPFNQEPEENEMTEFLPPTTLMFNLSDLKPQTLYRFQLRATTKVG
PGEMITQEGSTILKSGIPTFGNISAVTSENASTIYWFPEEGQHDVTFRIWFKPLGDKKNL
EPQHVNYSQKYYIQENLEPDTQYVICFYAYNYTDEMVLFRKMEVKTSGSDRMRLPPGNFA
TKSWFIIFISIIVLILLLLLILCFVKRSKGGKYSVKDKEDTQVDSEARPMKDETFGEYRS
LESFSILKYSDNEEKGFGSSQPSLNGDIKPLGSDDSLADYGGSVDVQFNEDGSFIGQYSG
KKEKEATGGNDSSGTTSPINPTHVTLE
Download sequence
Identical sequences F6PJP1
ENSMODP00000027544 ENSMODP00000027544

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]