SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000027558 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000027558
Domain Number 1 Region: 798-879
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000169
Family I set domains 0.012
Further Details:      
 
Domain Number 2 Region: 1150-1231
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000706
Family I set domains 0.014
Further Details:      
 
Domain Number 3 Region: 444-524
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000799
Family I set domains 0.012
Further Details:      
 
Domain Number 4 Region: 264-345
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000192
Family I set domains 0.019
Further Details:      
 
Domain Number 5 Region: 94-175
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000447
Family I set domains 0.022
Further Details:      
 
Domain Number 6 Region: 538-628
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000118
Family I set domains 0.02
Further Details:      
 
Domain Number 7 Region: 987-1053
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000161
Family I set domains 0.02
Further Details:      
 
Domain Number 8 Region: 616-697
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000209
Family I set domains 0.023
Further Details:      
 
Domain Number 9 Region: 1242-1330
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000027
Family I set domains 0.018
Further Details:      
 
Domain Number 10 Region: 1345-1412
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000275
Family I set domains 0.02
Further Details:      
 
Domain Number 11 Region: 1387-1492
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000104
Family I set domains 0.015
Further Details:      
 
Domain Number 12 Region: 186-274
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000258
Family I set domains 0.0088
Further Details:      
 
Domain Number 13 Region: 890-980
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000452
Family I set domains 0.03
Further Details:      
 
Domain Number 14 Region: 1035-1140
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000213
Family I set domains 0.014
Further Details:      
 
Domain Number 15 Region: 363-450
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000295
Family I set domains 0.01
Further Details:      
 
Domain Number 16 Region: 717-802
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000462
Family I set domains 0.021
Further Details:      
 
Domain Number 17 Region: 11-98
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000454
Family I set domains 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000027558   Gene: ENSMODG00000029368   Transcript: ENSMODT00000029098
Sequence length 1511
Comment pep:novel chromosome:BROADO5:Un:2426635:2427683:-1 gene:ENSMODG00000029368 transcript:ENSMODT00000029098 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIYVPLSKPTIITSNNTAVETKDFSMTCNATGQIHAYRWFINGLAPVGSRIQLSLDKRIL
TLHRLTRRENKGPYVCEIENPLFRNRSDPFPLNVTYGPDIATIVRSAGVYPTGVNITLSC
VADSNPPAQFTWLQNGQSVSNSAIFSVISSLNHAGTYTCIASNSFTGLTHTATKNIIIYA
PLSKPTIVISNITAVETKDFSLTCQATGQIHAYQWFINGVAPAGSRIQLSPDKRTLTLRR
LTRFDNKGPYECEIRNPFSSNRSDPFTLDVAYGPDIATIDRISDQFATGNNVTLSCVADS
NPPAQFTWLQNGQSVSNSASFSIITSLNHIGNYTCIATNSFTGLTRTANKTLMIYAPLSK
PTIITSNNTAVETKDFSMTCNATGQIHAYRWFINGLAPGGNRIQLSPDKRTLTIRSLRRM
ENKGPYVCEIENPLFRKRSNPFTLNVTYGPDNATIIHSANEYPTGANITLSCVADSNPAV
QFTWLHNGQPVSNSATFSIIASLSDAGTYTCTASNSFTGLTRTATKNIIIYAPLSKPTIV
TSNITAVETKDFSLTCQATGQIHTYQWFINGVAPAGSRIQLSPNKRTLTLSRLTRRDNKG
PYECEIQNPFYSNRSHPFTLDVAYGPDIATIDHISDQFATGINVTLSCVADSNPPAQFTW
LQNGKSVNNSASFSIITSLNHIGNYTCIATNSFTGLTRTANKTLMIYAPLSKPTILTSNN
TEVETKDFSLTCNATGQIHAYQWFINGVAPAGRRIQLSPDRRTLTLRSLTRSVNKGPYVC
EIENPFYRIRSDPFTLDVAYGPDITTIVHSPDEYPPGANITLSCVADSNPAAQFTWLHNG
QPVSNSATFSIIASLSDAGTYTCTASNSFTGLTRTATKNIIIYAPLSKPTIVTSNITAVE
TKDFSLTCQATGQIHAYQWFINGVAPAGSRIQLSADKRTLTLSRLTRRDNKGPYECEIRN
PIYNNRNDPFTLDVAYGPDIATIDHISDQFATGINVTLSCVADSNPPAQFTWLQNGQSVS
NSASFSIITSLNHIGNYTCIATNSFTGLTRTANKTLMIYAPLSKPTILTSNNTEVETKDF
SLTCNATGQIHSYKWFINGVAPAGRRIQLSPDRRTLTLRSLTRRDNKGPYVCEIENPFYR
NRSDPFTLDVAYGPDIATIVHSPDEYPTGANITLSCVADSNPAAQFTWLHNGQPVSNSAT
FSIIASLSDAGTYTCTASNSFTGLTCTATKNITIYAPLSKPTIVTSNITAVETKDFSLTC
QATGQIHTYQWFINGVAPAGSRIQLSPDKRTLTLSRLTRRDNKGPYECEIRNPFYSNRSD
PFTLDVAYGPDIATIDRISDQFATGINVTLSCVADSNPPAQFTWLQNGQSVSNSASFSII
TSLNHIGNYTCIATNSFTGLTRTANKTLMIYAPLSKPTIVTSNITAVETKDFSLTCQATG
QIHTYQWFINGVAPAGSRIQLSPDKRTLTLSRLTRRDNKGPYECEIRNPFYSNRSDPIHT
GCCLWPRYCHH
Download sequence
Identical sequences M9MMH9
ENSMODP00000022134 ENSMODP00000027558

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]