SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000027724 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000027724
Domain Number 1 Region: 32-364,457-479
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.11e-103
Family Motor proteins 0.00000285
Further Details:      
 
Domain Number 2 Region: 568-637
Classification Level Classification E-value
Superfamily RuvA domain 2-like 2.78e-21
Family ComEA-like 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000027724   Gene: ENSMODG00000015765   Transcript: ENSMODT00000029262
Sequence length 655
Comment pep:novel chromosome:BROADO5:6:158501988:158516309:1 gene:ENSMODG00000015765 transcript:ENSMODT00000029262 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVAAAAVAAATGATRCQMSKGRTSRRPSVARVRVAVRLRPFVEEASSTSESSCVRGLDS
CSLEIANGRNSQETLKYQFDAFYGETSTQQDIYVGFVQPILRHLMNGQNASVLAYGPTGA
GKTYTMLGSPEQPGIIPRALKDLLQLTWEEGAEGRPWAFAVSMSYLEIYQEKVLDLLAPA
SGDLVIREDRWGNILIPGLTQKPIASFTDFEQHFLPASRNRTVGATRLNQRSSRSHAVLL
VKVEQRERIAPFRQREGKLYLIDLAGSEDNRRTGNQGLRLKESGAINASLFVLGKVVDAL
NQGLPRVPYRDSKLTRLLQDSLGGSAHSVLIANIAPERRFYLDTVTSLNFASRSKEVINR
PFTHKSLQPPAFIPVKPGQKELMDPPEAKQTRSQEEMEDRTSIPELLSGCPKLSPLKQLN
TLEPAVQERLLNLDRILDSQGSHRTSILSTPRRERTALEKALKEKDLEIQRLKEKYKELE
ANRQSQKPKELEEEENGSLAPPCPLPSKTISMTKPLNRVVPFRLIQEQTTSQSKAHILQK
ESRKRKPEPICGQQEEQPERLCTTLELLQVPPDLLTESRRKILGLLNTGSAKELRRLQRI
GEKKAQLIVGWRELHGPFAEVEDLGQVEGISEKQVATFVKVRGAQAGPGRRGGWL
Download sequence
Identical sequences F6PIR6
ENSMODP00000027724 ENSMODP00000027724

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]