SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000027783 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000027783
Domain Number 1 Region: 1341-1652
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 4.81e-110
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000000000827
Further Details:      
 
Domain Number 2 Region: 1617-1907
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.68e-104
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000000000975
Further Details:      
 
Domain Number 3 Region: 322-516
Classification Level Classification E-value
Superfamily Fibronectin type III 1.09e-45
Family Fibronectin type III 0.00054
Further Details:      
 
Domain Number 4 Region: 514-711
Classification Level Classification E-value
Superfamily Fibronectin type III 2.53e-43
Family Fibronectin type III 0.00051
Further Details:      
 
Domain Number 5 Region: 824-1015
Classification Level Classification E-value
Superfamily Fibronectin type III 6.84e-37
Family Fibronectin type III 0.00065
Further Details:      
 
Domain Number 6 Region: 667-824
Classification Level Classification E-value
Superfamily Fibronectin type III 5.5e-30
Family Fibronectin type III 0.00084
Further Details:      
 
Domain Number 7 Region: 22-116
Classification Level Classification E-value
Superfamily Immunoglobulin 1.2e-18
Family I set domains 0.0038
Further Details:      
 
Domain Number 8 Region: 234-328
Classification Level Classification E-value
Superfamily Immunoglobulin 3.04e-16
Family I set domains 0.016
Further Details:      
 
Domain Number 9 Region: 126-217
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000144
Family I set domains 0.014
Further Details:      
 
Domain Number 10 Region: 1024-1146,1206-1254
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000161
Family Fibronectin type III 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000027783   Gene: ENSMODG00000015192   Transcript: ENSMODT00000029321
Sequence length 1915
Comment pep:novel chromosome:BROADO5:6:170357788:170820547:-1 gene:ENSMODG00000015192 transcript:ENSMODT00000029321 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIHVARPVVVLLYFVLYTEAETPPRFTRTPVDQTGVSGGVASFICQATGDPRPKIVWNKK
GKKVSNQRFEVIEFDDGSGSVLRIQPLRTPRDEAIYECVASNSVGEISVSTRLTVLREDQ
IPRGFPTIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPVDTSNNNGRIKQLRS
ESIGGTPIRGALQIELSEESDQGKYECVATNSAGTRYSAPANLYVRELREVRRVPPRFSI
PPTNHEIMPGGSVNITCVAVGSPMPYVKWMLGAEDLTPEDDMPIGRNVLELNDVRQSANY
TCVAMSTLGVIEAIAQITVKALPKPPGTPVVTESTATSITLTWDSGNPEPVSYYIIQHKP
KNSEEAYKEIDGVATTRYSVAGLSPYSDYEFRVVAVNNIGRGPPSEPVLTQTSEQAPSSA
PRDVQARMLSSTTILVQWKEPEEPNGQIQGYRVYYTMDPSQHVNNWMKHNVADSQITTIG
NLVPQKTYSVKVLAFTSIGDGPLSSDIQVITQTGVPGQPLNFKAEPESETSILLSWTPPR
SDTIASYELVYNDGDHGEEQRIPIEPSTSYRLQGLKPNSLYYFRLAARSPQGLGASTAEI
SARTMQSKPSAPPQDISCTSPSSTSILVSWQPPPVEKQNGIITEYSIKYTAMDGEDDKPH
EIVGIPSDTTQYLLEQLEKWTEYRISVTAHTDVGPGPESLSVLIRTDEDVPSGPPRKVEV
EAVNSTSVKVSWRSPVPNKQHGQIRGYQVHYVRMENGEPKGQPMLKDVMLADAQWEFDDT
TEHDMIISGLQPETAYSLTVTAYTTKGDGARSKPKLVSTTGAVPGKPRLVISHTQMNTAL
IQWHPPVDTFGPLQGYRLKFGRKDMEMLTTLEFSEKEDHFTAMDIHKGASYIFRLSAKNK
VGFGEEMVKEISVPEEVPNGFPQNLHSEGTTSTSVQLSWQPPVLAERNGIITKYTLLYRD
INIPHHPVEQLIVPADTTMTLTGLKPDTTYDVKVRAHTSKGPGPYSPSVQFRTLPVDQAV
FAKNFHVKAVMKTSVLLSWEIPENYNSAMPFKILYDDGKMVVEVDGRATQKLIVNLKPEK
SYSFVLTNRGNSAGGLQHRVTAKTAPDVLRTKPAFIGKTNLDGMITVQLPEVPANENIKG
YYIVIVPLKKSRGKFIKPWESPDEMELDELLKEISRKRRSLRHEREVELKPYIAAHFDVL
PTEFTLGDEKHYGGFTNKQLQSGQEYVFFVLAVMEHAESTMYATSPYSDPVVSMDLDPQP
MTDEEEGLIWVVGPVLAVVFIICIVIAILLYKRKRAESDSRKSSIPNSKEVPSHHPTDPV
ELRRLNFQTPGMASHPPIPILELADHIERLKANDNLKFSQEYESIDPGQQFTWENSNLEV
NKPKNRYANVIAYDHSRVLLSAIEGIPGSDYVNANYIDGYRKQNAYIATQGSLPETFGDF
WRMMWEQRGATVVMMTKLEERSRVKCDQYWPSRGTETYGLIQVTLLDTVELATYCVRTFA
LYKNGSSEKREVRQFQFTAWPDHGVPEHPTPFLAFLRRVKTCNPPDAGPMVVHCSAGVGR
TGCFIVIDAMLERIKHEKTVDIYGHVTLMRAQRNYMVQTEDQYIFIHDALLEAVTCGNTE
VPARNLYAYIQKLTQIETGENVTGMELEFKRLASSKAHTSRFISANLPCNKFKNRLVNIM
PYESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTI
VVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDAPGKDGQS
RTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITL
SIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDQYQFCYRAALEYLGSFDHYAT
Download sequence
Identical sequences F6S1W5
ENSMODP00000027783 ENSMODP00000027783

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]