SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000027872 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000027872
Domain Number 1 Region: 30-242
Classification Level Classification E-value
Superfamily L domain-like 1.01e-36
Family Ngr ectodomain-like 0.0056
Further Details:      
 
Domain Number 2 Region: 284-372
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000326
Family I set domains 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000027872   Gene: ENSMODG00000022969   Transcript: ENSMODT00000029409
Sequence length 499
Comment pep:novel chromosome:BROADO5:6:203334509:203336008:-1 gene:ENSMODG00000022969 transcript:ENSMODT00000029409 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASLALVGMLWAWLQTVHGNYGDNVSHALHHCPKVCICASDLLSCSNRNLHVVPAPLPVM
TTTLDLSYNMLPHLHPGWLAALPRLRKLRLAHNQLRSLARGTFHNASGLRCLDLSSNGLH
AVGRHDFEGLLELEELLLYNNHIGSVERGAFRGLGSLSRLYLSCNRLTEFSFRDLHGLSP
RQLRVLDLSTNRLDSIPVKEVVALPAFIKDGLYLHNNPIRCGCSLYHMLLRWRQRGFRSV
CDYLEEHVCVAFEVPSSRVRFFTHSKVFENCSSLGPSPERPDVHLEVQLGQPLLIPCDAG
APATRYAWVSPSNELVVFPGNKDNSIRVLSNGSLSIRKAQASHAGVFVCLAAGSRLHHNQ
THEYNVTVRPAPHESESFNTGFTTLLGCVVSLILVLLYLFLTPCSCCCRCCRPGPLIPPQ
ECSAQSSILSSTPPAADGPGRKASTHKHVVFLEPVKEGQNGRVKLAVSEDFDLRNPKILQ
VKSDSESISSMFSDTPIMS
Download sequence
Identical sequences F6UY13
ENSMODP00000027872 XP_007499919.1.35504 13616.ENSMODP00000027872 ENSMODP00000027872

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]