SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000028150 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000028150
Domain Number 1 Region: 25-197
Classification Level Classification E-value
Superfamily PR-1-like 1.44e-39
Family PR-1-like 0.00021
Further Details:      
 
Domain Number 2 Region: 300-444
Classification Level Classification E-value
Superfamily C-type lectin-like 3.15e-26
Family C-type lectin domain 0.00083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000028150   Gene: ENSMODG00000014564   Transcript: ENSMODT00000029730
Sequence length 454
Comment pep:novel chromosome:BROADO5:1:707868485:707892858:1 gene:ENSMODG00000014564 transcript:ENSMODT00000029730 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ELPPMQGPWAFLTLLLGLLRFTRAEIQMPQLQKEGPLYQALSLKESFLLLALHNRLRSKV
HPPAANMQRMDWSEQLARMAQEQAAQCSAQALLPTGFQALQVGWNVQLLPAGVASFTDVV
TSWFQEGQWYAYSAAQCASNLSCAHYTQLVWATSSQLGCGKHLCNVGLLEMEAFACAYSP
GGNWEMNGKTIVPYKKGAWCSLCTAGVSGCFKAWDHGGGLCEVPRNPCRMSCRNNGHLNV
STCHCHCPPGYTGRYCQVRCSVRCQHGRFREEECSCLCDVGYGGAECAIKVQFPFHACDL
WIDGSCFMVSPEADTYYGAKSKCQEKGGMLAQIENQKVQDILAFYLGRLETNNEVTDADF
ETRNFWIGLTYKTSKDSFRWATGEHYSFTSFAFGQPDNQGWKCQVWRSRGLGFGNCVELQ
ASAAFNWNDQRCKTRNRYICQFAQKHISQWNLEP
Download sequence
Identical sequences F7GBZ1
ENSMODP00000028150 ENSMODP00000028150 13616.ENSMODP00000028150

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]