SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000028153 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000028153
Domain Number 1 Region: 18-186
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 3.48e-35
Family MHC antigen-recognition domain 0.0013
Further Details:      
 
Domain Number 2 Region: 197-284
Classification Level Classification E-value
Superfamily Immunoglobulin 4.5e-18
Family C1 set domains (antibody constant domain-like) 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000028153   Gene: ENSMODG00000023068   Transcript: ENSMODT00000029733
Sequence length 324
Comment pep:novel chromosome:BROADO5:1:705429402:705434596:1 gene:ENSMODG00000023068 transcript:ENSMODT00000029733 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ILDPLFSFLPIHSCSAAHHKHMIQFTMVGTGSSLLEYFIVDFLDDVQVFSFNKYNHQLIA
KEAWISQVLGAKFIEDTWQKLVDHEKSFLWFLRKLMQNSTKSDMNHTVQLFILCEIERNN
QLGNEIQIAVNGQDFCWLDEKYGDWFIMVPEAEPFKPILTSNLWTTQRKHYMQEYCIDTM
KKILQHSSIKKNVPPEVTVSYHEAMDGITTLSCSATGFYPSSILLHWQKKEKKIVVGKES
SSGLLPNADSTFYQRVFIELPPEETGTNYDCVVEHIELGTPKVYPAHVKSSKKRSRTLTL
AILGVVILVLSSIASFIMWHKIKT
Download sequence
Identical sequences F7GBX1
ENSMODP00000028153 13616.ENSMODP00000028153 ENSMODP00000028153

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]