SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000028608 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000028608
Domain Number 1 Region: 501-787
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.74e-75
Family Protein kinases, catalytic subunit 0.000000661
Further Details:      
 
Domain Number 2 Region: 219-418
Classification Level Classification E-value
Superfamily Fibronectin type III 9.74e-28
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 3 Region: 133-210
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000106
Family I set domains 0.0005
Further Details:      
 
Domain Number 4 Region: 33-139
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000141
Family V set domains (antibody variable domain-like) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000028608   Gene: ENSMODG00000006666   Transcript: ENSMODT00000030191
Sequence length 936
Comment pep:novel chromosome:BROADO5:1:593743540:593840901:1 gene:ENSMODG00000006666 transcript:ENSMODT00000030191 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EVTPMLSGNPHRRHAEMPGAVSENVISSLAFKHTIGHVILSEHKDVKFNCSISVPNTYLD
TAVISWWKDGKELLGAHHVITHFYPDDEFTAIIAPFSINNVQRPDNGSYFCKLRINSDEI
VSEPIYIEVQGLPYFIKHPESINVSKNTAFNLTCQAVGPPEPVSIFWIRNSSRINDKPEK
SPSVLTVSGLTEAATFSCEAHNDKGLTVSKEGQVNIKAIPSAPSEVIIKNKTAHTLLISW
VPGFDGYSPFINCSVHVKEVSPLTNASVIIFNTSASPHLYQIQQLQALANYSIGVSCMNE
VGWSQVSPWILASTTEGAPSASPLNVTVFLNSSSNNLEVRWKKPPLKRQDGELMGYTISY
MWQGEGIFKEYSEEVDQNDSFALLSVLATNTTCTVKIAVVTKGGIGPFSDPVNVFIPPNG
MIDLAPSSTPAPGNTDPIIIILGCLCGIILIGLILYISLAIRKRLQETKFGSAFREEASE
LVVNYKAKKSFSRRAIELTLSSLGVSEELQNKLEDVVIDRNLLTLGKILGEGEFGSVMEG
NLNEQDGTSQKVAVKTMKLDNFSQSEIEEFLSEAACMKDFDHPNVITLLGVCLEMSSQRI
PKPMVILPFMKYGDLHTYLLYSRLETGPKHVPLQTLLKFMVDIALGMEYLSNRNFLHRDL
AARNCMLRDDMTVCVADFGLSKKIYSGDYYRQGRIAKMPVKWIAIESLADRVYTSKSDVW
AFGVTMWEIATRGMTPYPGVQNHEIYDYLIHGHRLKQPDDCLDELYEIMSSCWRVNPLDR
PTFSELKLRLEKLLESLLDGQEKADVIYINTRLLEDYEGMAEDPMFTQMEMDIDPNYIIA
SCTPKPDSSVVTVEMHENHLNEERYILNGLSEEWEMLPLTAPTSVTPEQMNTVLLEDKVL
RNGATWSQSSTLPMSSTLHDELLYADDSSEDSEVLM
Download sequence
Identical sequences F6ZJI2
ENSMODP00000028608 13616.ENSMODP00000028608 ENSMODP00000028608

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]