SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000028685 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000028685
Domain Number 1 Region: 295-402
Classification Level Classification E-value
Superfamily Immunoglobulin 7.69e-16
Family C1 set domains (antibody constant domain-like) 0.005
Further Details:      
 
Domain Number 2 Region: 189-302
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000818
Family V set domains (antibody variable domain-like) 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000028685   Gene: ENSMODG00000023163   Transcript: ENSMODT00000030268
Sequence length 446
Comment pep:novel chromosome:BROADO5:2:518577292:518592332:-1 gene:ENSMODG00000023163 transcript:ENSMODT00000030268 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRWITLEGTRSPGNVLGMLGRGMLALRLLSPGLLWILGWHMVESGMTLGKAGQLPCLLEV
ALDPSETLNGERKWQHIQLVLSGSESQSLSHQGNSATFLLQDRAGVLLPHMDEDVDKLEC
KVSRYFTANTQILWPGLPPRQAQLPTWHLVTISHTDAQFKASTFCFQSAESAQGTGPAIF
SGVFSLYTKASRVQVELYGTVLLACSFVMDHAPEALDVRWALRQKGGKQREILKYDGKQR
QVTHLHEQVEAFPSEIPGGDASIRLNNVAVNDQGDYFCSVSTAGLYWELSIEVAVVEAPK
VRFSPQTPILTLEEGEEEKLVCDVRHYFPLEAHVFWLRERLEGRMMPEGVKNVLFSSHRK
NGDETFSFSSYYLLKASLQDDGFRYTCLVEHEGLRFPIRKSIIIRVTEKSGSSWGLLIIL
IILMVVIFVLLRYLHQVKSMNKTKPY
Download sequence
Identical sequences F7FZS9
ENSMODP00000028685 ENSMODP00000028685 XP_007485846.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]