SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000028989 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000028989
Domain Number 1 Region: 42-137
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000125
Family V set domains (antibody variable domain-like) 0.0056
Further Details:      
 
Domain Number 2 Region: 159-232
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000565
Family I set domains 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000028989   Gene: ENSMODG00000005170   Transcript: ENSMODT00000030567
Sequence length 278
Comment pep:novel chromosome:BROADO5:2:489036567:489094300:-1 gene:ENSMODG00000005170 transcript:ENSMODT00000030567 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASWEDSIISIIIILAGAIALIIGFGISGRHSITVTTLTSAGNIGEDGILSCTFEPEIKL
SDIVIQWLKEGVIGLVHEFKEGKDDLSDQNDMFKGRTAVFADQVIVGNASLKLKNVQLTD
AGTYKCYIITSKGKGNAKLEYKTGAFSIPEVNVDYNASSESLRCEAPRWFPQPTVAWASQ
VDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTVNNTYSCMIENDIAKATGDIKVTDSE
IKKRGHLQLLNSEAALLGSTFCVLSWVLLPLAPHLMLF
Download sequence
Identical sequences F7AUV8
ENSMODP00000028989 XP_007485325.1.35504 XP_007485326.1.35504 XP_007485330.1.35504 XP_007485332.1.35504 XP_016284596.1.35504 XP_016284597.1.35504 XP_016284598.1.35504 XP_016284599.1.35504 ENSMODP00000028989

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]