SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000029072 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000029072
Domain Number 1 Region: 31-244
Classification Level Classification E-value
Superfamily L domain-like 1.29e-37
Family Ngr ectodomain-like 0.0056
Further Details:      
 
Domain Number 2 Region: 280-358
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000158
Family I set domains 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000029072   Gene: ENSMODG00000023243   Transcript: ENSMODT00000030650
Sequence length 493
Comment pep:novel chromosome:BROADO5:2:478583089:478584570:-1 gene:ENSMODG00000023243 transcript:ENSMODT00000030650 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQHQSGCRGIWLLPLSLFLSSLGVARTGRSLLSCPTGCLCASNILSCTKRGLSNVPQSLP
RYTAFLDLSHNNLTHLRAQWTTIHLIHLQSLFLSHNHLHFISTEAFTPVPGLRYLDLSSN
HLKTLDESLFSELKNLEVLLLYSNQIVEVDRSAFDDMVNLQKLYLSQNQIARFPVELVKD
RSKLPSLTLLDLSSNKLKLLPTADLQDLPAWMKNGLYLHNNSLSCDCEIQKLFTHWQYRQ
LSSVTDFQEDLYCMYSKKMYSVFNITTLNCSEFKECAFEAYLGESLIISCDTKQQGMTKE
WVTPNNEKVLNEVGNGTVKVLQNGSLQFEHIRVEDQGLYTCYAVGEAFNETLSVEVKVHN
FTRHGPHDTLNTAYTTLVGCILSVVLVLIYLYLTPCRCWCRAGERPTSHQGDSLSSSMLS
TTPNHDPMAGGGGKDSGFDRRVAFLEPTGPGQGQNGKLKPGNTLPVPEGAKGQRKMSDPE
SVSSVFSDTPIVV
Download sequence
Identical sequences F6TWW3
XP_007485151.1.35504 ENSMODP00000029072 ENSMODP00000029072 13616.ENSMODP00000029072

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]