SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000029106 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000029106
Domain Number 1 Region: 82-170
Classification Level Classification E-value
Superfamily EF-hand 1.54e-17
Family Calmodulin-like 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000029106   Gene: ENSMODG00000002832   Transcript: ENSMODT00000003518
Sequence length 248
Comment pep:novel chromosome:BROADO5:2:472243983:472244729:-1 gene:ENSMODG00000002832 transcript:ENSMODT00000003518 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AMASQELSLKLHRRLRLEQEAEVIRIPQQNGLYAVPAPAWPCGSPSQGNKLPAEELMAKV
GAELKEQLNRRQGMHKGTARLPPIKVFKLYTEFPEFSHRQIKDMESLFRRYDSGKDGYID
LMQLKLMMEKLGAPQTHLGLKEMIRKVDEDLDSKLSFREFLLIFSKAASGGLGSEISLIS
LAKLSEINVAIEGVKGAKNFFEAKVYDLSMTSRFEAEIKAEQNARKQEAEDRKQRRALFR
ERRAAFSQ
Download sequence
Identical sequences F6YAL6
ENSMODP00000029106 ENSMODP00000029106 13616.ENSMODP00000029106

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]