SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000029356 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000029356
Domain Number 1 Region: 40-147
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.88e-31
Family Spermadhesin, CUB domain 0.00046
Further Details:      
 
Domain Number 2 Region: 154-348
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.37e-16
Family Pentraxin (pentaxin) 0.0067
Further Details:      
 
Domain Number 3 Region: 852-1139
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000000000000439
Family Rhodopsin-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000029356   Gene: ENSMODG00000017273   Transcript: ENSMODT00000030930
Sequence length 1194
Comment pep:novel chromosome:BROADO5:2:419833968:420033094:1 gene:ENSMODG00000017273 transcript:ENSMODT00000030930 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMFYTSRMWSCHWKWKLHPLLVFLTLYVICIHHSVWGCANCRVTLSNPSGIFTSPCYPNE
YPNSQVCMWTLRAPTGYIIQITFNDFDIEEAPDCIYDSLSLDNGESQTKFCGATAKGLSF
NSSANEMHVSFSSDFSIPKKGFNASYIRVAVSLRNQKVIIPQTTDANQVSVAKTVSIPEL
SAFTVCFEATKIGNEDDWIAFSYSDASSTQLLSFGKVKRGYFLSIFGVECPLNKVLSVDS
QEDIFTENFEQLCLTWNSSLGSVSVNFKRSYETVICNSTISKVIPGNGKLLLGSNQNEIA
SLKGDIYNFRLWNFNMNSKTLSNLSCNVKGNVVDWQNDFWNIPTSVLKAENNLSCGSYLI
PLQASELTSCADLGTLCQATVNSPTTPPIVTTNMPVTNRVDNQRNDGIIYRISMIIQNML
HQPEVKVQSKVAEWLNSTFQNWNYTVYVVNISLHMNTGEEKIKVKRSTEDDQRLMIWALL
VYNDTNNISLEGQLIEEKLLGSNESLGDGLRLYTVSVKQIGTCPENEHPEGYKWSTTKPA
VQIQPCKGKPGYFASRTCHQDTTNKTYWGTPDLTNCAVGVKEMANELLNFTSEGQTLTSA
NITSIVEYLKKIVNNEENIDITLGSTVMTIFSNILTSSDNELLESSSEALKTIDELAFKI
KLSNEVPVNITTRNLALGVSSLTPETYEGSTFSIGLPNSNDSYFQMDFETGQVNSLASVI
LPRSLLMNLSKEESESVRRAQFTFFNKTGLFQAKTQRDKLVSYVMACSIGNISIRDLQEP
VQVIIKHTRNQVLHPICVFWDLNKNKGFGGWNTSGCVAQQESNESETVCLCNHLTHFGVL
MDLQRTASQIDTRNTKVLTFITYIGCGVSAIFSAATLLTYVAFEKLRRDYPSKILMNLST
ALLFLNLIFLLDGWITSFDIDGLCVAVAALLHFFLLATFTWMGLEAVHMYIALVKVFNTY
IRRYILKFCIIGWGLPALVVTVILASRNTNANEIYGKERYGRDIKGQGNEFCWIQDPVVF
YVTCAGYFGVMFLLNVAMFIVVMVQICGRNGKRSNRTLREEILRNLRSVVSLTFLLGMTW
GFAFFAWGPLNIAFMYLFSFFNSLQGLFIFVFHCAMKENVQKQWRRHLCCGRFRLADNSD
WSKTATNIIKKSSDNLGKSLSSSSIGSNSTYLTSKSKSNSTTYFKRNSHPDNVF
Download sequence
Identical sequences F6VSG8
ENSMODP00000029356 ENSMODP00000029356

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]