SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000029774 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000029774
Domain Number 1 Region: 22-116
Classification Level Classification E-value
Superfamily Immunoglobulin 3.22e-32
Family V set domains (antibody variable domain-like) 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000029774   Gene: ENSMODG00000023412   Transcript: ENSMODT00000031345
Sequence length 123
Comment pep:novel chromosome:BROADO5:3:524415197:524415693:1 gene:ENSMODG00000023412 transcript:ENSMODT00000031345 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAWPLVCLSLLTFCSGSLSQDVVTQPPSASAALGSSARLSCTLSSASSSYYVYWHQQSPG
KAPRYLLYVTSSGGTGRGDGIPERFSGSGSGTNRFLSISNVQPEDEADYFCQAYYGSGSN
YRY
Download sequence
Identical sequences F6Q3N8
ENSMODP00000015622 ENSMODP00000027100 ENSMODP00000029774 ENSMODP00000015622 ENSMODP00000027100 ENSMODP00000029774 13616.ENSMODP00000015622 13616.ENSMODP00000027100 13616.ENSMODP00000029774

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]