SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000029777 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000029777
Domain Number 1 Region: 2-100
Classification Level Classification E-value
Superfamily Immunoglobulin 9.25e-31
Family V set domains (antibody variable domain-like) 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000029777   Gene: ENSMODG00000023418   Transcript: ENSMODT00000031347
Sequence length 111
Comment pep:novel chromosome:BROADO5:3:524283513:524284477:1 gene:ENSMODG00000023418 transcript:ENSMODT00000031347 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QAVVTQPPSASAALGSSARLSCTLSSGNSGNNVGWHQQSPGKPPRYLLYVTSSGGTGRGD
GIPERFSGSGSGTNRFLSISNVQPEDEADYFCQSYHYPDTFQGRKRGEYIR
Download sequence
Identical sequences F6T8V0
ENSMODP00000029777 ENSMODP00000029777 13616.ENSMODP00000029777

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]