SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000030146 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000030146
Domain Number 1 Region: 114-277
Classification Level Classification E-value
Superfamily C-type lectin-like 2.45e-20
Family C-type lectin domain 0.0046
Further Details:      
 
Domain Number 2 Region: 38-77
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000681
Family LDL receptor-like module 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000030146   Gene: ENSMODG00000010056   Transcript: ENSMODT00000031717
Sequence length 556
Comment pep:novel chromosome:BROADO5:3:514062561:514144932:-1 gene:ENSMODG00000010056 transcript:ENSMODT00000031717 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPQADSGAFVLLFLLVLTGTEPLRPGPPLALARLLSELRCNPGQFACRSGAIHCIPLSW
QCDGRGACEDESDEVGCPDVPGDQRSYHGKEAMDSRPSRGRGDTTRFHMVNVAQPVRFSS
FLGKCPTGWHHYEGTASCYKVYLNGENYWDALQTCQRVNGSLVVFTTDQELRFVLAQEWD
LQERTFGWKDQRKFWVGYQYVITGRNRSLEGHWEVAHKGPSEDFLKPPDPIFASAVPEND
NVLCAQLQCFHFPTLRHHDLHSWYAENCYEKSSFLCKRSQTCVDIKDNIVGEGYHFTPKG
NDPCLSCTCHNGEPEMCVAALCEGPQGCQQYDKDPKECCKFMCLDPDGSSLFDSMASGMR
LIVSCISSFLILSLLLFMVHRLRQRRRERIESLIGANLHHFNLGRRIPGFDYGPDGFGTG
LTPLHLSDDGEGGAFHFHDPPPPYTAYKYPDIQHPDDPPPPYEASIDPSSALCAPSDGVC
PQPAPSSPPSLADSDASPRLAEGPLPPSGGPPSAELDDSADSSTLLVPPDTPLRENGPAG
PVGGSRPSLCSLNTIV
Download sequence
Identical sequences F7EH13
ENSMODP00000030146 XP_016288005.1.35504 ENSMODP00000030146

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]