SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000030692 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000030692
Domain Number 1 Region: 17-250
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.89e-82
Family Eukaryotic proteases 0.00000339
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000030692   Gene: ENSMODG00000006536   Transcript: ENSMODT00000032262
Sequence length 252
Comment pep:novel chromosome:BROADO5:4:397480620:397493149:1 gene:ENSMODG00000006536 transcript:ENSMODT00000032262 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLLTLMVLALVTGRGRAETRIIKGYECPAHSQPWQVALFQKSRLHCGATLINRQWLLTA
AHCKKPQYWVYLGEHNLQRPDSCEQKRMATLSFPHPGFNGSLPNKDHRNDIMLVKMNSPV
MLTRGVKPLALPEDCATAGSQCLISGWGTTTSPQLTLPHTLRCANITLIDHRECEGAYPG
NITDTMVCAGVTKEGKDSCQGDSGGPLVCNGTLQGIISWGQDPCAVSRKPGVYTKVCKYV
DWIHETIKDNSP
Download sequence
Identical sequences F7EWW6
ENSMODP00000030692 ENSMODP00000030692 XP_007492232.1.35504 XP_007492233.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]