SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000031262 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000031262
Domain Number 1 Region: 324-417
Classification Level Classification E-value
Superfamily Immunoglobulin 1.54e-20
Family I set domains 0.012
Further Details:      
 
Domain Number 2 Region: 222-321
Classification Level Classification E-value
Superfamily Immunoglobulin 4.74e-19
Family I set domains 0.008
Further Details:      
 
Domain Number 3 Region: 27-123
Classification Level Classification E-value
Superfamily Immunoglobulin 4.19e-18
Family I set domains 0.0054
Further Details:      
 
Domain Number 4 Region: 126-220
Classification Level Classification E-value
Superfamily Immunoglobulin 3.95e-17
Family I set domains 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000031262   Gene: ENSMODG00000002676   Transcript: ENSMODT00000032833
Sequence length 472
Comment pep:novel chromosome:BROADO5:4:386809394:386922518:-1 gene:ENSMODG00000002676 transcript:ENSMODT00000032833 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPISTVLLCLGDMWAGPSTVTQTQRLPKPDIFAEPSSVVAPGTNVTLRCLALQWTSQEL
LFTLSKAGSPGYPHPDKTGTEARFSLPSVNVRDAGSYSCFYSERRPAKGKSETSETLDLV
VTGLLKPVLFAEPSTVVAPGTNVTLHCLALQWTSREFLFTLSKAGSLGYPHPDKTGSEAR
FSLPSVKVKDAGSYSCFYSERRPAKGKSETSETVDLVVTGSLPQPSLQALPSAKVSLNGT
VTLRCVLPVKPSLGSVMFMWLKAGTPEPLGQSLQQSQRWANFTLPSVTVQDAGSFRCVYY
EKTVQPRASEPSEPLNVCVTDSLTRPSLTVEPSSSVSLGEKMTLWCQSASCGTRFTLHKD
GEDKPVQTIDSLQDKAGFLIPHVTHEHAGTYYCLHHRGEDLPTLALYSDHLELSVSGEQE
LLLHKATEWGDGGALPVVNTYPVNNLIRICLAALVLVVIGMVLSYDCHSPRS
Download sequence
Identical sequences F6QR94
ENSMODP00000031262 13616.ENSMODP00000031262 ENSMODP00000031262

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]