SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000031323 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000031323
Domain Number 1 Region: 521-809
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.09e-74
Family Protein kinases, catalytic subunit 0.000000667
Further Details:      
 
Domain Number 2 Region: 219-416
Classification Level Classification E-value
Superfamily Fibronectin type III 7.7e-26
Family Fibronectin type III 0.002
Further Details:      
 
Domain Number 3 Region: 135-218
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000198
Family I set domains 0.0012
Further Details:      
 
Domain Number 4 Region: 15-115
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000126
Family V set domains (antibody variable domain-like) 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000031323   Gene: ENSMODG00000008491   Transcript: ENSMODT00000032894
Sequence length 886
Comment pep:novel chromosome:BROADO5:4:385297650:385319210:1 gene:ENSMODG00000008491 transcript:ENSMODT00000032894 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGSTRMGRAGLAWCLALWCWGSWAREGVWDPFVTGPGNVTGARGRGAVLRCEVRVAGEA
PEVSWLRDGQVLELADSTQTQVPLGEDGQDDWKVVSQLRISALQLSDAGRYQCSVAVEGE
TFLSPPAYVGLEGLPYFLEEPGDMTVPADTPFNLTCQAQGPPDPVNLLWLQDGAPLASHN
PTKGLLHLPGLNKTSSFSCEAHNAKGVTTSRTAMVTVLPQRPQHLQPVSSSPTTLEVAWT
PGASGIYPITNCALQAVLSDDGVGPGPGAMEPPEEPLAFQIAVPPHSLHLENLQPHSAYH
IRVACASSQGPSSWTHWVLVETPEGVPMGPPENVSAIRNGSQALVRWQPPRAPLQGTLQG
YKLAYREEDAPEVLVDAGLRREVTLELRGEGVLPNLTLRVAAYTTAGDGPWSVPVQLEPW
RPGDGQPIHQHVKDPPAPAFSWPWWYVLLGAVTAAACVLLLALFLFHRRKKETRYGEVFQ
PTVERGELVVRYRVRKSYSRRTTEATLNSLGISEELKEKLRDVMVDRHKVALGKTLGEGE
FGSVMEGQLNQDDSILKVAVKTMKIAICTRSEMEDFLSEAVCMKEFDHPNVMRLIGVCLQ
GSECEGFPSPVVILPFMKHGDLHSFLLYSRLGDQPMFLPTQTLVKFMADIASGMDYLSTK
RFIHRDLAARNCMLNENMSVCVADFGLSKKIYNGDYYRQGRIAKMPVKWIAIESLADRVY
TSKSDVWSFGVTMWEIATRGQTPYPGVENSEIYDYLRQGHRLKQPLDCLDGLYELMSRCW
SLSPRDRPTFAELREELEMTLKGLPPTQDPEEILYVNMDGEPAGAAGGTPQASPLPVPKA
SCNCSCITSADVHPAGRYVLCPSTAPGPPMPTTRRPPAPPGQEEGA
Download sequence
Identical sequences F6VDX1
ENSMODP00000031323 ENSMODP00000031323 XP_001372007.2.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]