SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000031341 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000031341
Domain Number - Region: 140-267
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.0432
Family Hermes transposase-like 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000031341   Gene: ENSMODG00000023718   Transcript: ENSMODT00000032912
Sequence length 269
Comment pep:novel chromosome:BROADO5:1:348583963:348584854:1 gene:ENSMODG00000023718 transcript:ENSMODT00000032912 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RIFKERWTYDYFFMQYKERAVCLICQNIVSVFKEYNLHQHYQTQHKDKYDCLLNISSPRA
SFQVAKLIEWRENLLECLLSVAKETCPEKADLFSTVSLSGSTNGRQFASDLQNSARKLSY
FSLALKKSNDVCDSAQLLIFIRGTNDNVKVTEELAAVQSIKGTTTGEDIYEKVSQTVKDL
ELDWAKLASVTTDGAPSTVGSKKGVIAHINQEMDKYNHSHPIAIYCLIHQQVLLYSKSLK
WDSVMKIVVSCVNFIRANALNHRQFQEFL
Download sequence
Identical sequences F6UVK2
13616.ENSMODP00000031341 ENSMODP00000031341 ENSMODP00000031341

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]