SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000031730 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000031730
Domain Number 1 Region: 34-146
Classification Level Classification E-value
Superfamily Immunoglobulin 4.47e-23
Family V set domains (antibody variable domain-like) 0.00015
Further Details:      
 
Domain Number 2 Region: 153-270
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000147
Family V set domains (antibody variable domain-like) 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000031730   Gene: ENSMODG00000023801   Transcript: ENSMODT00000033303
Sequence length 271
Comment pep:novel chromosome:BROADO5:4:377904201:377926814:-1 gene:ENSMODG00000023801 transcript:ENSMODT00000033303 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLLLLLLILMIGVAFLPTESLSQDTGYELNATTSVTVQEGLCIQIPCSFSYPFETIHSG
QPAYGFWFRDGAKIYEDKLVVTNHPRREVQEEARGRFQLVGDPKENNCSLSIMEVQKRDS
GLYFFRIERGSIRYSYIKFMVNVTVKGSLSQHPKYNVQVPESVAVEERLCINILCSFSHP
LTNVSEFLGFWFKDGADTDKENPVASKNLNQMVKEKARGQFHLIVDPKKDNCSLHITDTQ
KGDSGKYFFWIERGKKVKFNYQNNKFNLNVT
Download sequence
Identical sequences F6RSX8
ENSMODP00000031730 13616.ENSMODP00000031730 ENSMODP00000031730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]