SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000031738 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000031738
Domain Number 1 Region: 22-139
Classification Level Classification E-value
Superfamily Immunoglobulin 8.93e-18
Family V set domains (antibody variable domain-like) 0.00011
Further Details:      
 
Domain Number 2 Region: 364-448
Classification Level Classification E-value
Superfamily Immunoglobulin 6.37e-17
Family I set domains 0.033
Further Details:      
 
Domain Number 3 Region: 260-344
Classification Level Classification E-value
Superfamily Immunoglobulin 1.65e-16
Family I set domains 0.022
Further Details:      
 
Domain Number 4 Region: 141-229
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000811
Family C2 set domains 0.043
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000031738
Domain Number - Region: 418-501
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00499
Family I set domains 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000031738   Gene: ENSMODG00000020818   Transcript: ENSMODT00000033311
Sequence length 530
Comment pep:novel chromosome:BROADO5:4:377574302:377601715:1 gene:ENSMODG00000020818 transcript:ENSMODT00000033311 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SFLLALSLTQMARGSHGGSLSQVLQVPSSVTVQEGLCAQVLCTFYPRYSIDKSYPAYGSW
FREWTNTDYGKPVATNARGRQVERGAQGRFRLLGDPQRKNCSLSISDARTTDSGRYFFRF
EQGEEKYNIYHSLLSVSVTGLSQKPDISVPEVLEAGTPVTLNCTFPSACWDDSTYRFSWS
GAALPSPHNGSGPSPSSEVSFTPGLQHHGTPVTCQVTLPGGYLTAQRTIFLNVSYAAQNM
TISLSQGNRTTVWVPGIGSSPVVVQEGESLHLLCAANSRPPATLSWMLGNQTLVSSQPSD
DAVLSLKLPQLRPADGGKYTCLAQHPLGSKNVSLIISVQYSPQNISISVFQRNGTEEENY
KEGTPLLILEGESLKLDCAAASNPPATLSWSLGDRNLTSLQTSYPGVLSLEMTSLREEDG
GEYMCQAHNRLGAQNLSLYLSVQYPPRMLNLSCSKTNGSIFCTCSAQAVPAPSLDWWIGE
SALEKNSSEDTLREVSITSGTWTNSRLSMKKELNQNLKIRCEGKNQYGVH
Download sequence
Identical sequences F6RSL4
13616.ENSMODP00000031738 ENSMODP00000031738 ENSMODP00000031738

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]