SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000031777 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000031777
Domain Number 1 Region: 13-212
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.39e-63
Family Eukaryotic proteases 0.000000324
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000031777   Gene: ENSMODG00000027369   Transcript: ENSMODT00000033352
Sequence length 236
Comment pep:novel chromosome:BROADO5:4:376156187:376161462:-1 gene:ENSMODG00000027369 transcript:ENSMODT00000033352 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGSVLLIAFLGYASSCGVPTYMPNLANRVVGGEDVRPHSWPWQVSLQYLKDDTFRHTCG
GSLISSQHVLTAAHCISKDKTYRVLLGKNNLVEEEADAVAAAVDTIFVHEKWNSFLVRND
IALIKLAEPVELSDTIQVACLPPEGSLLAHDYPCYVTGWGRLWTNGPIADNLQQGFLPIV
DHTTCTKSDWWGSMVTQKMVCAGGDGVISACNVSHSPERQVQGWGKLGLLGENGAN
Download sequence
Identical sequences F6QKR1
ENSMODP00000031777 ENSMODP00000031777

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]