SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000031965 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000031965
Domain Number 1 Region: 39-129
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000055
Family V set domains (antibody variable domain-like) 0.0033
Further Details:      
 
Domain Number 2 Region: 173-246
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000637
Family I set domains 0.022
Further Details:      
 
Domain Number 3 Region: 240-323
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000166
Family I set domains 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000031965   Gene: ENSMODG00000023856   Transcript: ENSMODT00000033539
Sequence length 351
Comment pep:novel chromosome:BROADO5:4:370474534:370495961:-1 gene:ENSMODG00000023856 transcript:ENSMODT00000033539 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNEHMKFPFGDFQRNGPWPGHLLTAFLLCFQLQLTPAELTITPIPSRPVEGENITLFVQG
FIGEDLMSFNWFRGSTTDLAQQILTFVSMSGTQSMGKAYTGRERAEADGSLHISSSHLND
SGIYTIRQIFFPTDSGSNMVSTNVYLPVYVVPTERNSPRRQTDEYLGSGNPSCSPLSSGV
TLRWFVDNELVTESDRLQLSADRRTLTIPRVSRDDSGIYQCETRNELTFGPSSPFVINVT
YGPDPPVLRPEGSDFVVGSNLTLSCFASSNPAAHYIWWVNGTAGPSGQQLFIPNISGGKS
EVYACHATNPDSGLHSTAEIAVSISGKLPLLAQDGATAGITIGILVGVVLT
Download sequence
Identical sequences F6XKG8
ENSMODP00000031965 ENSMODP00000031965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]