SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000031972 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000031972
Domain Number 1 Region: 77-158
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000139
Family I set domains 0.0054
Further Details:      
 
Domain Number 2 Region: 249-340
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000251
Family I set domains 0.0083
Further Details:      
 
Domain Number 3 Region: 175-247
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000226
Family I set domains 0.014
Further Details:      
 
Domain Number 4 Region: 3-61
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000129
Family V set domains (antibody variable domain-like) 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000031972   Gene: ENSMODG00000023858   Transcript: ENSMODT00000033546
Sequence length 472
Comment pep:novel chromosome:BROADO5:4:370426150:370455045:-1 gene:ENSMODG00000023858 transcript:ENSMODT00000033546 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSYNADTGVHNEGSAFTGRESLPANGSLIINEVYLNDSGHYSILVKSREGPLMSANGSFQ
VFVKPSKPDILREGGDVIEFQTSVKFSCVSQDVGVNIQWFLNNTDLPPSPLLSLSPDNKT
LTFHNVTRRDRGYYQCEAWNLVGAQSSESIFLLVYYGPDQVMITSQDGTVWGNIIAVKTN
SNVTLQCLTESNPDPSYTWLFNESSWLGSETNYFISSASRTDEGNYTCSVKNRMTLRSSS
ASVTVKVVEQVTKPQLLVSNKSVVEDEGAVNFTCVTPDTEIEVQWFLDKQKLWPSDQLVL
SQGNRTLTIAQARREDAGEYQCTTRNLISSSNSDPITLTVYYSSLSAGEIAGIVIGVLAF
VAFITGLIYFLVIRKRKADPPSSTADSPPRKVDPPPEPSQDRQRPVTPRPKAPLVPPSFP
KGPQDNPIYQRELPGRDNHFPLPRIPGPEEESLYEKLSEPYADVYVKIKPAA
Download sequence
Identical sequences F6X3H7
ENSMODP00000031972 ENSMODP00000031972

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]