SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000032000 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000032000
Domain Number 1 Region: 85-161
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000274
Family I set domains 0.0091
Further Details:      
 
Domain Number 2 Region: 177-264
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000297
Family I set domains 0.012
Further Details:      
 
Domain Number 3 Region: 3-91
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000399
Family I set domains 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000032000   Gene: ENSMODG00000023865   Transcript: ENSMODT00000033574
Sequence length 280
Comment pep:novel chromosome:BROADO5:4:368913842:368919007:1 gene:ENSMODG00000023865 transcript:ENSMODT00000033574 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KPTISTSNKTAVETKDFSLTCQATGQIDTYQWLINGLPAAGSRIQLSPDKRTLTISRLTR
RENKGPYVCEIQNPLFRKKSNPFTLDVAYGPDTATIVHTVDEYPVGANITLSCSADSNPP
AQFIWLQNGQSVSNSATFSIIASLSDAGTYTCTASNSFTGLTHNASKTIIIYGPLLKPTI
NSPNRIPVENVDSVSLTCNATGQIDTYRWLINKRAPTDNSIQLSQDMTTLTIPSLTRKHE
GSYVCEIKNPFYSSRSNPFRLNVNYGPDHAAIVPIINKYP
Download sequence
Identical sequences F6YUF9
ENSMODP00000032000 ENSMODP00000032000 13616.ENSMODP00000032000

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]