SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000032224 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000032224
Domain Number 1 Region: 172-428
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.79e-86
Family Eukaryotic proteases 0.0000572
Further Details:      
 
Domain Number 2 Region: 482-730
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.47e-84
Family Eukaryotic proteases 0.0001
Further Details:      
 
Domain Number 3 Region: 808-1008
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.66e-62
Family Eukaryotic proteases 0.0000975
Further Details:      
 
Domain Number 4 Region: 144-183
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000252
Family LDL receptor-like module 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000032224   Gene: ENSMODG00000004782   Transcript: ENSMODT00000033801
Sequence length 1037
Comment pep:novel chromosome:BROADO5:3:455307954:455359828:1 gene:ENSMODG00000004782 transcript:ENSMODT00000033801 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAAVANLDPTPSNTKAQLAVDTSCWKVTVATVLASAIAVIFLGLLLASLYTQDLSFEHS
AELKGILYDSSLQQETSSYYRALTPALERLVSWDVRSDTDKPRETLRQGLAMRFREHSIP
LPTYGTIYSAALTEMCRLGSSLSPGRCPGNAFACQSNQCVSKVNPECDGKVDCSDGSDEA
HCDCGGRPALKSANRIVGGMEAARGEFPWQVSLRENNEHFCGAAILGAKWLVSAAHCFNE
FQDPTVWMAYAGTTFLSGSDSGTVKARVAQIIKHPFYNSDTADFDVAVLELGSPLPFTSH
IQPVCLPSATHVFPPRKKCLISGWGYLKEDFLVKPEVLQKATVELLDQALCASLYSNALT
DRMVCAGYLDGKVDSCQGDSGGPLVCDEPSGRFFLAGIVSWGIGCAEARRPGVYVRVTRV
RDWILETISTAPTVSAPAVFSDSTTSSNWLLMTEKLVTSTTTKPKMVTELDGASLYPGTT
ARPQECGGRPGMLKPNKIVGGFDAARGEVPWQVSLKEGSRHFCGATVVGERWLVSAAHCF
NHTKMDFVKAYVGTTSLTGADGSAVKVSIKSVVLHPSYNPVILDFDVAVLELASPLLFNK
YIQPVCLPLTIQKFPVGQKCMISGWGNTHEGNATKPEILQKASVGIIDQKTCSVLYNFSL
TDRMICAGFLEGKIDSCQGDSGGPLACEETPGVFYLAGVVSWGIGCAQAKKPGVYSRMTR
LKDWIVDTISPGLQTSSTLSPEKTPLVTSQALGATSSTTTTRVTTSKLTPPPTSKTTPKP
TSITTLKTTSQPTSQPTSRTTSRPTTSKTTPRPTNCGISPVGTLTKIVGGSAASRGEWPW
QVSLWLRRKEHKCGAVLIADRWLLTAAHCFDVYSDPNMWVAFLGTASLSGVDGKVEKVYR
IYKHPFYNVYTLDYDVALLELSAPVRYTSVIKPICLPDHSHLFAEGTKCFITGWGSIREG
GMMARHLQKAVVNIIGEETCRKFYPIQISNRMLCAGFAQGGVDSCSVSSQARLSLSITRL
LPGPHLTWKHSPTSPHS
Download sequence
Identical sequences F7FY57
ENSMODP00000032224 ENSMODP00000032224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]